|
||||||
|
UniGene Name: sp_v3.0_unigene81232
Length: 228 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81232
G |
|
Ace file of the UniGene sp_v3.0_unigene81232 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Homeobox_KN multi-domain protein | - | - | 5.0e-19 | 62% |
| FL-Next | tr=Homeobox transcription factor KN4; Picea mariana (Black spruce) (Abies mariana). | - | - | 0.0 | 51% |
| Sma3 | Bel1 homeotic protein, putative | - | - | 9.348e-28 | - |
| Source | Gene names |
|---|---|
| Sma3 | AP22.90; ATH1; At1g19700; At1g75410; At1g75430; At2g16400; At2g23760; At2g27220; At2g27990; At2g35940; At4g32980; At4g34610; At4g36870; At5g02030; At5g41410; BEL1; BELL1; BIHD1; BIP; BL1; BL2; BL3; BL4; BLH1; BLH10; BLH11; BLH2; BLH3; BLH4; BLH5; BLH6; BL |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | protein heterodimerization activity | GO:0046982 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | oligopeptide transport | GO:0006857 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of cell proliferation | GO:0008285 | Biological Process | 0.0 | - |
| Sma3 | response to symbiotic fungus | GO:0009610 | Biological Process | 0.0 | - |
| Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
| Sma3 | maintenance of floral meristem identity | GO:0010076 | Biological Process | 0.0 | - |
| Sma3 | maintenance of inflorescence meristem identity | GO:0010077 | Biological Process | 0.0 | - |
| Sma3 | fruit development | GO:0010154 | Biological Process | 0.0 | - |
| Sma3 | polar nucleus fusion | GO:0010197 | Biological Process | 0.0 | - |
| Sma3 | secondary shoot formation | GO:0010223 | Biological Process | 0.0 | - |
| Sma3 | floral organ abscission | GO:0010227 | Biological Process | 0.0 | - |
| Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
| Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
| Sma3 | regulation of gibberellin biosynthetic process | GO:0010371 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | floral whorl morphogenesis | GO:0048457 | Biological Process | 0.0 | - |
| Sma3 | regulation of timing of transition from vegetative to reproductive phase | GO:0048510 | Biological Process | 0.0 | - |
| Sma3 | organ formation | GO:0048645 | Biological Process | 0.0 | - |
| Sma3 | internode patterning | GO:0080006 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
| Sma3 | Homeodomain | IPR001356 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
| Sma3 | POX | IPR006563 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF604 | IPR006740 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G36870.1 | BLH2, SAW1 BEL1-like homeodomain 2 chr4:17369423-17373723 FORWARD LENGTH=739 | 2.0e-27 | 88% |
| RefSeq | Arabidopsis thaliana | NP_195405.4 | BEL1-like homeodomain protein 2 [Arabidopsis thaliana] | 3.0e-27 | 88% |
| RefSeq | Populus trichocarpa | XP_002328315.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 92% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q5SC62
Fln msg: STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 75 - 438
Fln protein:
S
Protein Length:
76
Fln nts:
G
Fln Alignment:
GDTE5QK01EULWY___LRAWLFEHFLHPYPTDADKHILAKQTGLSRSQVSNWFINARVRLWKP
Q5SC62_______________LLEWWNVHYKWPYPSETDKVSLAESTGLDQKQINNWFINQRKRHWKP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
