UniGene Name: sp_v3.0_unigene81227
Length: 242 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81227
C |
Ace file of the UniGene sp_v3.0_unigene81227 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP-dependent RNA helicase dhh1 [Coprinopsis cinerea okayama7#130] gb|EAU89171.1| ATP-dependent RNA helicase dhh1 [Coprinopsis cinerea okayama7#130] | - | - | 3.0e-39 | 96% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | DEAD-box ATP-dependent RNA helicase 6 | - | - | 9.382e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides. | EC:3.6.1.- | - | 3.362e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 3.362e-11 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 3.362e-11 | % | |
| Sma3 | Folate biosynthesis | 00790 | 3.362e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.362e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G54270; AT3G13920; AT4G00660; AT5G11200; At1g54270; At1g72730; At2g45810; At3g13920; At3g19760; At3g61240; At4g00660; At5g11170; At5g11200; CHLREDRAFT_188942; CHLREDRAFT_56005; CHLREDRAFT_608; DEH1; EIF4A; EIF4A3; F20D21.9; F20D21_52; F28P22.8; F2I11_6 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | translation initiation factor activity | GO:0003743 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | rRNA processing | GO:0006364 | Biological Process | 0.0 | - |
| Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
| Sma3 | regulation of translation | GO:0006417 | Biological Process | 0.0 | - |
| Sma3 | mRNA transport | GO:0051028 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | RNA helicase, DEAD-box type, Q motif | IPR014014 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G00660.2 | RH8, ATRH8 RNAhelicase-like 8 chr4:274638-277438 FORWARD LENGTH=505 | 0.0 | 88% |
| RefSeq | Arabidopsis thaliana | NP_191975.2 | DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana] | 0.0 | 88% |
| RefSeq | Populus trichocarpa | XP_002320116.1 | predicted protein [Populus trichocarpa] | 0.0 | 90% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKI3
Fln msg: STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 80 - 477
Fln protein:
H
Protein Length:
81
Fln nts:
C
Fln Alignment:
GDTE5QK01BWVRQ___HDFRNGVCRNLVCSDLLTRGIDIQAVNVVINFDFPKNSETYLHRIGRSGRFGHLGLAINLVTFDDRFNLYRIEQELGTEI
B8LKI3_______________HDFRNGACRNLVCSDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)