|
||||||
|
UniGene Name: sp_v3.0_unigene81201
Length: 242 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene81201
C |
|
Ace file of the UniGene sp_v3.0_unigene81201
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Beta-fructofuranosidase, insoluble isoenzyme 2 n=1 Tax=Daucus carota RepID=INV2_DAUCA | - | - | 8.0e-16 | 68% |
| FL-Next | sp=Beta-fructofuranosidase, insoluble isoenzyme 2; Daucus carota (Carrot). | - | - | 0.0 | 68% |
| Sma3 | Acid invertase | - | - | 1.417e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:2.4.1.10- | - | 5.162e-08 | - | |
| Sma3 | Beta-fructofuranosidase. | EC:3.2.1.26 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Galactose metabolism | 00052 | 0.0 | % | |
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | EC:3.2.1.8- | - | 3.427e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | 1-FEH; 1-feh; 1-feh IIb; 6-feh; A211; AI; AI-2; AIV-1; At1g12240; At1g62660; At1g62660/T3P18.21; At3g13784; At3g13790; At3g52600; At5g11920; BFRUCT1; BFRUCT2; Beta-fruct; C311; CIN1; CIN2; CIN4; CIN6; CWI-1; CWINV; CWINV1; CWINV2; CWINV5; CWINV6; CitINV1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | beta-fructofuranosidase activity | GO:0004564 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | 1,2-beta-fructan 1F-fructosyltransferase activity | GO:0047207 | Molecular Function | 0.0 | - |
| Sma3 | sucrose 1F-fructosyltransferase activity | GO:0050306 | Molecular Function | 0.0 | - |
| Sma3 | fructan beta-fructosidase activity | GO:0051669 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 32 | IPR001362 | - | 0.0 | - |
| Sma3 | Histone H4 | IPR001951 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolases family 32, N-terminal | IPR013148 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolase family 32, C-terminal | IPR013189 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 32, active site | IPR018053 | - | 0.0 | - |
| Sma3 | Peptidase S26A, signal peptidase I, conserved site | IPR019758 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13790.1 | ATCWINV1, ATBFRUCT1 Glycosyl hydrolases family 32 protein chr3:4533084-4535831 REVERSE LENGTH=584 | 9.0e-20 | 64% |
| RefSeq | Arabidopsis thaliana | NP_566464.1 | beta-fructofuranosidase [Arabidopsis thaliana] | 1.0e-19 | 64% |
| RefSeq | Populus trichocarpa | XP_002309496.1 | predicted protein [Populus trichocarpa] | 4.0e-20 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q39692
Fln msg: Distance to subject end: 495 aas, your sequence is shorter than subject: 80 - 592
Fln protein:
W
Protein Length:
81
Fln nts:
C
Fln Alignment:
GDTE5QK01ANJ4U___NTTGTNVQIRYRTAYHFQPQKNWMNDPNAPMFYKGFYHLFYQYNPQGA
Q39692_______________SVSAVNVQLVHRTGYHFQPKKHWINDPNGPMYYKGFYHLFYQYNPKGA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
