UniGene Name: sp_v3.0_unigene81194
Length: 185 nt
![]() |
---|
>sp_v3.0_unigene81194
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Laccase n=2 Tax=Pinus taeda RepID=Q9AUI3_PINTA | - | - | 3.0e-23 | 88% |
FL-Next | tr=Laccase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 88% |
Sma3 | Laccase | - | - | 7.186e-41 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 2.618e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 2.618e-29 | % | |
Sma3 | Metabolic pathways | 01100 | 2.618e-29 | % |
Source | Gene names |
---|---|
Sma3 | At1g18140; At2g29130; At2g30210; At2g38080; At2g40370; At5g01040; At5g01050; At5g03260; At5g05390; At5g07130; At5g58910; At5g60020; B1088C09.5; F15A17_290; F16M14.1; F7J8.20; F7J8.30; GLac3; GLac90; GSVIVT00007673001; GSVIVT00007675001; GSVIVT00007681001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | Laccase | IPR017761 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G07130.1 | LAC13 laccase 13 chr5:2210567-2212525 FORWARD LENGTH=569 | 1.0e-24 | 77% |
RefSeq | Arabidopsis thaliana | NP_196330.3 | laccase 13 [Arabidopsis thaliana] | 1.0e-24 | 77% |
RefSeq | Populus trichocarpa | XP_002319955.1 | predicted protein [Populus trichocarpa] | 2.0e-22 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9AUI3
Fln msg: Distance to subject end: 288 aas, your sequence is shorter than subject: 61 - 570
Fln protein:
E
Protein Length:
62
Fln nts:
G
Fln Alignment:
GDTE5QK01BKLNY___ETKLLRVINAALNTDLFFSVGGHKMTVVAVDASYTKPFQTNILMLGPGQTTDVLLTADQAS
Q9AUI3_______________ETKLLRVINAALNTDLFFTVGGHTMTVVAVDALYTKPFQTNLLMLGPGQTTDVLVTADQTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain