SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene81187

Length: 169 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene81187
ACAATCTCTTCTTATTGAGGGGATCTCCAACAATACTACAGGAAGTGTCTTTAAACCTGAGGGTGGTGGAGAAATAGAGGTGACAGGATCACCGACAGAGAAGGCTCTTATTTCTTGGGCATTAAAGCTTGGAATGAATTTTGATAACGAAAGATCCAAATCCTCCATC

Ace file of the UniGene sp_v3.0_unigene81187 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Autoinhibited calcium ATPase (Fragment) n=1 Tax=Populus trichocarpa RepID=B9IN45_POPTR	-	-	2.0e-16	70%
FL-Next	sp=Calcium-transporting ATPase 8, plasma membrane-type; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	67%
Sma3	Autoinhibited calcium ATPase	-	-	9.843e-12	-

Source	ECs	Term	Type	e value	Identity
Sma3	Calcium-transporting ATPase.	EC:3.6.3.8	-	8.517e-13	-

Source	Gene names
Sma3	ACA10; ACA8; ACA9; AT5G57110; At3g21180; At4g29900; At5g57110; CA8; CA9; F27B13.140; GSVIVT00025300001; MUL3.5; MXL8.3; MtrDRAFT_AC155895g7v2; OSJNBa0035M09.2; OSJNBb0015N08.12; Os02g0176700; Os04g0605500; Os08g0517200; OsI_06071; OsI_17291; OsI_29887; Os

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	calcium-transporting ATPase activity	GO:0005388	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	calmodulin binding	GO:0005516	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	GO:0015662	Molecular Function	-
Sma3	protein self-association	GO:0043621	Molecular Function	-
Sma3	ATP biosynthetic process	GO:0006754	Biological Process	-
Sma3	cation transport	GO:0006812	Biological Process	-
Sma3	calcium ion transport	GO:0006816	Biological Process	-
Sma3	single fertilization	GO:0007338	Biological Process	-
Sma3	pollen development	GO:0009555	Biological Process	-
Sma3	response to nematode	GO:0009624	Biological Process	-
Sma3	inflorescence morphogenesis	GO:0048281	Biological Process	-
Sma3	shoot development	GO:0048367	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, P-type, H+ transporting proton pump	IPR000695	-	-
Sma3	ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter	IPR001757	-	-
Sma3	ATPase, P-type cation-transporter, N-terminal	IPR004014	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	ATPase, P-type cation-transporter, C-terminal	IPR006068	-	-
Sma3	ATPase, P-type cation exchange, alpha subunit	IPR006069	-	-
Sma3	ATPase, P-type, calcium-transporting, PMCA-type	IPR006408	-	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	-
Sma3	ATPase, P-type, ATPase-associated domain	IPR008250	-	-
Sma3	ATPase, P-type phosphorylation site	IPR018303	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G57110.1	ACA8, AT-ACA8 autoinhibited Ca2+ -ATPase, isoform 8 chr5:23109729-23116857 REVERSE LENGTH=1074	1.0e-20	67%
RefSeq	Arabidopsis thaliana	NP_851200.1	calcium-transporting ATPase 8 [Arabidopsis thaliana]	1.0e-20	67%
RefSeq	Populus trichocarpa	XP_002325251.1	autoinhibited calcium ATPase, partial [Populus trichocarpa]	1.0e-21	70%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9LF79

Fln msg: Distance to subject end: 505 aas, your sequence is shorter than subject: 56 - 1074

Fln protein: QSLLIEGISNNTTGSVFKPEGGGEIEVTGSPTEKALISWALKLGMNFDNERSKSSI

Protein Length: 57

Fln nts: ACAATCTCTTCTTATTGAGGGGATCTCCAACAATACTACAGGAAGTGTCTTTAAACCTGAGGGTGGTGGAGAAATAGAGGTGACAGGATCACCGACAGAGAAGGCTCTTATTTCTTGGGCATTAAAGCTTGGAATGAATTTTGATAACGAAAGATCCAAATCCTCCATC

Fln Alignment:

GDTE5QK01BXONF___SLLIEGISNNTTGSVFKPEGGGEIEVTGSPTEKALISWALKLGMNFDNERSKSSI
Q9LF79_______________SLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILGWGVKLGMNFETARSQSSI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain