UniGene Name: sp_v3.0_unigene81186
Length: 215 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene81186
G |
Ace file of the UniGene sp_v3.0_unigene81186
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | WD-repeat protein, putative | - | - | 8.357e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g15750; At1g80490; At3g15880; At5g27030; CTV.2; F15P11.3; F7H2.9; GSVIVT00000315001; GSVIVT00003228001; GSVIVT00014065001; GSVIVT00016938001; GSVIVT00022669001; GSVIVT00032753001; GSVIVT00032754001; GSVIVT00032755001; GSVIVT00032757001; LOC_Os03g14980; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
| Sma3 | primary shoot apical meristem specification | GO:0010072 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-2 | IPR000560 | - | 0.0 | - |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | LisH dimerisation motif | IPR006594 | - | 0.0 | - |
| Sma3 | CTLH, C-terminal LisH motif | IPR006595 | - | 0.0 | - |
| Sma3 | LisH dimerisation motif, subgroup | IPR013720 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Cytochrome b5, heme-binding site | IPR018506 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G16830.1 | TPR2 TOPLESS-related 2 chr3:5731709-5737531 FORWARD LENGTH=1131 | 1.0e-36 | 90% |
| RefSeq | Arabidopsis thaliana | NP_188306.2 | Topless-related 2 protein [Arabidopsis thaliana] | 2.0e-36 | 90% |
| RefSeq | Populus trichocarpa | XP_002328986.1 | predicted protein [Populus trichocarpa] | 3.0e-37 | 92% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACF1
Fln msg: Distance to subject end: 53 aas, your sequence is shorter than subject: 71 - 178
Fln protein:
R
Protein Length:
72
Fln nts:
G
Fln Alignment:
GDTE5QK01CAW66___RYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVEILVKDLKVFSSFNEELYKEITQLLTLDNFR
D5ACF1_______________RYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKQDRERAVEILAKDLKVFSSFNEELFKEVTQLLTLDNLR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta