UniGene Name: sp_v3.0_unigene81155
Length: 134 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81155
G |
Ace file of the UniGene sp_v3.0_unigene81155 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Respiratory burst oxidase, putative n=1 Tax=Ricinus communis RepID=B9RG33_RICCO | - | - | 2.0e-13 | 72% |
| FL-Next | sp=Respiratory burst oxidase homolog protein D; Solanum tuberosum (Potato). | - | - | 0.0 | 70% |
| Sma3 | NADPH oxidase | - | - | 1.076e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidoreductases, Acting on a peroxide as acceptor, Peroxidases. | EC:1.11.1.- | - | 1.246e-19 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 1.246e-19 | % | |
| Sma3 | Oxidoreductases, Acting on NADH or NADPH, With a oxygen as acceptor. | EC:1.6.3.- | - | 8.499e-21 | - |
| Sma3 | NAD(P)H oxidase. | EC:1.6.3.1 | - | 3.491e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g64060; At4g25090; At5g07390; At5g47910; At5g51060; B1060H01.16; F13M23.230; F22C12.18; GSVIVT00002525001; GSVIVT00006233001; GSVIVT00006235001; GSVIVT00016386001; K3K7.25; LOC_Os11g33120; MCA23.25; MtrDRAFT_AC154391g18v2; NbrbohA; NbrbohB; OSJNBb0036G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | NAD(P)H oxidase activity | GO:0016174 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor | GO:0050664 | Molecular Function | 0.0 | - |
| Sma3 | respiratory burst involved in defense response | GO:0002679 | Biological Process | 0.0 | - |
| Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of programmed cell death | GO:0043069 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide biosynthetic process | GO:0050665 | Biological Process | 0.0 | - |
| Sma3 | defense response by callose deposition | GO:0052542 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome b245, heavy chain | IPR000778 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | FAD-binding 8 | IPR013112 | - | 0.0 | - |
| Sma3 | Ferric reductase, NAD binding | IPR013121 | - | 0.0 | - |
| Sma3 | Flavoprotein transmembrane component | IPR013130 | - | 0.0 | - |
| Sma3 | NADPH oxidase Respiratory burst | IPR013623 | - | 0.0 | - |
| Sma3 | Ferredoxin reductase-type FAD-binding domain | IPR017927 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G64060.1 | ATRBOH F, ATRBOHF, RBOHAP108, RBOHF, RBOH F respiratory burst oxidase protein F chr1:23770266-23776317 FORWARD LENGTH=944 | 1.0e-16 | 68% |
| RefSeq | Arabidopsis thaliana | NP_564821.1 | respiratory burst oxidase [Arabidopsis thaliana] | 2.0e-16 | 68% |
| RefSeq | Populus trichocarpa | XP_002303736.1 | predicted protein [Populus trichocarpa] | 3.0e-18 | 70% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q2HXK9
Fln msg: Distance to subject end: 354 aas, your sequence is shorter than subject: 44 - 858
Fln protein:
G
Protein Length:
45
Fln nts:
G
Fln Alignment:
GDTE5QK01C26RI___GIVMVVLMVVAFTLATPLFRKNKVKLPRPLQRIAGFNAFWYSHH
Q2HXK9_______________GIIMVVLMSIAFTLASQRFRRNKIRLPRPLNKLTGFNAFWYSHH

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)