UniGene Name: sp_v3.0_unigene81154
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene81154
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|O81767.2|PP348_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33990; AltName: Full=Protein EMBRYO DEFECTIVE 2758 gb|AEE86306.1| pentatricopeptide repeat-containing | - | - | 4.0e-19 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.668e-12 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g15510; At1g20230; At2g22070; At4g33990; At5g08510; At5g44230; At5g48910; At5g66520; EMB2758; F17I5.180; F8L15.21; GSVIVT00000293001; GSVIVT00000621001; GSVIVT00000673001; GSVIVT00000680001; GSVIVT00002188001; GSVIVT00002920001; GSVIVT000033 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33990.1 | EMB2758 Tetratricopeptide repeat (TPR)-like superfamily protein chr4:16290141-16292612 REVERSE LENGTH=823 | 2.0e-24 | 60% |
RefSeq | Arabidopsis thaliana | NP_567948.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-24 | 60% |
RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 177 aas, your sequence is shorter than subject: 70 - 312
Fln protein:
F
Protein Length:
71
Fln nts:
T
Fln Alignment:
GDTE5QK01D0B1F___MIRDHGITPRMEHYGCMVDLLGRNGHLQEACDFISRMPIKPSAAVWGALLSACRVHCNLDIGKCAAEHL
D5ADG9_______________MTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAELL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain