|
||||||
|
UniGene Name: sp_v3.0_unigene81148
Length: 180 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene81148
G |
|
Ace file of the UniGene sp_v3.0_unigene81148
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | NADH dehydrogenase subunit 5 (Fragment) n=1 Tax=Taxus canadensis RepID=Q85QD7_TAXCA | - | - | 4.0e-16 | 97% |
| FL-Next | sp=NADH-ubiquinone oxidoreductase chain 5; Triticum aestivum (Wheat). Mitochondrion. | - | - | 0.0 | 72% |
| Sma3 | NADH-ubiquinone oxidoreductase chain 5 | - | - | 3.00298e-41 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NADH dehydrogenase (ubiquinone). | EC:1.6.5.3 | - | 2.308e-32 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 2.308e-32 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.308e-32 | % |
| Source | Gene names |
|---|---|
| Sma3 | MicpuC_mit40; MicpuN_mit25; NAD5; ND5; OtMtg00360; POPTRDRAFT_812198; nad5; nadh dehydrogenase subunit 5; nd5; orf399; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial respiratory chain | GO:0005746 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | NADH dehydrogenase (ubiquinone) activity | GO:0008137 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | ATP synthesis coupled electron transport | GO:0042773 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NADH:ubiquinone oxidoreductase, chain 5/L, N-terminal | IPR001516 | - | 0.0 | - |
| Sma3 | NADH:ubiquinone/plastoquinone oxidoreductase | IPR001750 | - | 0.0 | - |
| Sma3 | IPR003916 | - | 0.0 | - | |
| Sma3 | NADH-plastoquinone oxidoreductase, chain 5 | IPR003945 | - | 0.0 | - |
| Sma3 | NADH dehydrogenase subunit 5, C-terminal | IPR010934 | - | 0.0 | - |
| Sma3 | NADH-plastoquinone oxidoreductase, chain 5 subgroup | IPR018393 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | ATMG00665.1 | NAD5B, NAD5.2, NAD5 NADH dehydrogenase 5B chrM:190740-190761 REVERSE LENGTH=669 | 2.0e-20 | 72% |
| RefSeq | Arabidopsis thaliana | NP_085478.1 | NADH dehydrogenase subunit 5 (mitochondrion) [Arabidopsis thaliana] | 2.0e-20 | 72% |
| RefSeq | Populus trichocarpa | XP_002333105.1 | predicted protein [Populus trichocarpa] | 5.0e-19 | 95% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q37680
Fln msg: Distance to subject end: 552 aas, your sequence is shorter than subject: 60 - 670
Fln protein:
G
Protein Length:
61
Fln nts:
G
Fln Alignment:
GDTE5QK01EB1YY___RFADWFDPEFTSDP---VFDSPTVVMLIVVTFVSSLVHLYSISYMSEDPHSPRFMCYLS
Q37680_______________RIAPWISSEMFDASWGFLFDSLTVVMLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
