|
||||||
|
UniGene Name: sp_v3.0_unigene81101
Length: 108 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene81101
G |
|
Ace file of the UniGene sp_v3.0_unigene81101
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | protein serine/threonine kinase-like protein [Arabidopsis thaliana] | - | - | 3.0e-09 | 90% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 4.765e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G10290; AT5G63710; AT5G65240; At5g10290; At5g63710; At5g65240; F18D22_60; GSVIVT00005359001; GSVIVT00017119001; GSVIVT00029507001; LOC_Os03g49620; LRR-RLK; MpRLK28; OSJNBa0004L11.14; OSJNBa0018M09.11; Os02g0283800; OsI_06766; OsI_13188; OsJ_06271; OsJ_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Calponin homology domain | IPR001715 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
| Sma3 | Adenovirus E3 region protein CR2 | IPR003470 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G10290.1 | leucine-rich repeat transmembrane protein kinase family protein chr5:3235462-3238171 REVERSE LENGTH=613 | 1.0e-13 | 90% |
| RefSeq | Arabidopsis thaliana | NP_196591.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 1.0e-13 | 90% |
| RefSeq | Populus trichocarpa | XP_002309974.1 | predicted protein [Populus trichocarpa] | 1.0e-13 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSK3
Fln msg: Distance to subject end: 293 aas, your sequence is shorter than subject: 35 - 606
Fln protein:
L
Protein Length:
36
Fln nts:
G
Fln Alignment:
GDTE5QK01EHEEY___LATDNFSEKNVLGQGGFGKVYKGILGDKTKVAV
C0PSK3_______________IATDNFSEKNVLGQGGFGKVYKGVLGDNTKVAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
