|
||||||
|
UniGene Name: sp_v3.0_unigene81091
Length: 158 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81091
A |
|
Ace file of the UniGene sp_v3.0_unigene81091 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Similar to Kinesin proteins [Arabidopsis thaliana] | - | - | 7.0e-16 | 69% |
| FL-Next | sp=Kinesin-2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 70% |
| Sma3 | Kinesin, putative | - | - | 1.078e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g05190; ATK1; ATK2; ATK3; ATK4; At1g55550; At1g63640; At1g72250; At1g73860; At2g22610; At2g28620; At2g36200; At2g47500; At3g10310; At4g05190; At4g21270; At4g27180; At5g27000; At5g27950; At5g54670; B1317D11.110; B21F5.3; CHLREDRAFT_105722; CHLREDRAFT_12 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | minus-end kinesin complex | GO:0005872 | Cellular Component | 0.0 | - |
| Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
| Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
| Sma3 | spindle microtubule | GO:0005876 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | microtubule binding | GO:0008017 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | minus-end-directed microtubule motor activity | GO:0008569 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | anastral spindle assembly involved in male meiosis | GO:0009971 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | spindle assembly | GO:0051225 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | FERM domain | IPR000299 | - | 0.0 | - |
| Sma3 | MyTH4 domain | IPR000857 | - | 0.0 | - |
| Sma3 | Bet v I domain | IPR000916 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Calponin homology domain | IPR001715 | - | 0.0 | - |
| Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Telomere end binding protein | IPR011564 | - | 0.0 | - |
| Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | FERM/acyl-CoA-binding protein, 3-helical bundle | IPR014352 | - | 0.0 | - |
| Sma3 | FERM central domain | IPR019748 | - | 0.0 | - |
| Sma3 | Band 4.1 domain | IPR019749 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G55550.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr1:20748915-20752862 FORWARD LENGTH=859 | 6.0e-21 | 69% |
| RefSeq | Arabidopsis thaliana | NP_564696.2 | P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] | 7.0e-21 | 69% |
| RefSeq | Populus trichocarpa | XP_002319535.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-19 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P46864
Fln msg: Distance to subject end: 259 aas, your sequence is shorter than subject: 52 - 745
Fln protein:
H
Protein Length:
53
Fln nts:
A
Fln Alignment:
GDTE5QK01EJ7WA___FDKVFLPEDSQDDVFEELVPILRSALDGHNVCIFAYGQTGTGKTYTMEGRP
P46864_______________FDKVFVPSASQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
