UniGene Name: sp_v3.0_unigene81083
Length: 236 nt
![]() |
---|
>sp_v3.0_unigene81083
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SY02.1|PP301_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02750 gb|AAD15348.1| hypothetical protein [Arabidopsis thaliana] emb|CAB77760.1| hypothetical protein | - | - | 6.0e-17 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | Pentatricopeptide, putative | - | - | 9.304e-06 | - |
Source | Gene names |
---|---|
Sma3 | At1g17630; At3g16610; At3g49170; At4g02750; At4g21300; At5g19020; EMB2261; F1L3.33; F2K15.30; GSVIVT00001706001; GSVIVT00002423001; GSVIVT00006516001; GSVIVT00006853001; GSVIVT00007922001; GSVIVT00010363001; GSVIVT00011422001; GSVIVT00012454001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | lipid binding | GO:0008289 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | lipid transport | GO:0006869 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Plant lipid transfer protein/Par allergen | IPR000528 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | IPR003612 | - | 0.0 | - | |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR008512 | - | 0.0 | - | |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Plant lipid transfer protein/hydrophobic protein helical domain | IPR013770 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 9.0e-22 | 63% |
RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-21 | 63% |
RefSeq | Populus trichocarpa | XP_002314911.1 | predicted protein [Populus trichocarpa] | 4.0e-21 | 58% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 212 aas, your sequence is shorter than subject: 72 - 370
Fln protein:
K
Protein Length:
73
Fln nts:
G
Fln Alignment:
GDTE5QK01D8U91___KDALHLFEQMQLGGIKPDGITFVAVLSSCSHVGLVDDGRQFFESMSQDHGIEPEADHYACMVDL
A9P0W0_______________KEAVLLFEQMLQTGVKPNQITFVVVLSGCSHAGLVDEGRNYFDSMTRDHGISPKAEHYSCMVDL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain