SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene81074

Length: 180 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene81074
CAATCCGGAAGCGACTAGTTCAACTCTGGATTCGGATGGTTGGCTACGAACAGGCGATCTCTGTTACATTGATGAAGAAGGCTACATCTTTGTAGTGGACAGATTGAAAGAGCTTATCAAATATATGGGTTACCAGTCATAATCTGCATCTCTTTGAGAAGTCTCTTAACTTGTTGATGT

Ace file of the UniGene sp_v3.0_unigene81074 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]	-	-	1.0e-16	82%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	78%
Sma3	Acyl:coa ligase	-	-	9.796e-17	-

Source	ECs	Term	Type	e value	Identity
Sma3	Photinus-luciferin 4-monooxygenase (ATP-hydrolyzing).	EC:1.13.12.7	-	6.029e-17	-
Sma3	Ligases, Forming carbon-sulfur bonds, Acid--thiol ligases.	EC:6.2.1.-	-	1.771e-30	-

Source	KEGGs	Term	e value	Identity
Sma3	Geraniol degradation	00281	1.771e-30	%
Sma3	Tyrosine metabolism	00350	1.771e-30	%
Sma3	Benzoate degradation	00362	1.771e-30	%
Sma3	Fluorobenzoate degradation	00364	1.771e-30	%
Sma3	alpha-Linolenic acid metabolism	00592	1.771e-30	%
Sma3	Aminobenzoate degradation	00627	1.771e-30	%
Sma3	Propanoate metabolism	00640	1.771e-30	%
Sma3	Ethylbenzene degradation	00642	1.771e-30	%
Sma3	Carbon fixation pathways in prokaryotes	00720	1.771e-30	%
Sma3	Limonene and pinene degradation	00903	1.771e-30	%
Sma3	Tropane, piperidine and pyridine alkaloid biosynthesis	00960	1.771e-30	%
Sma3	Biosynthesis of plant hormones	01070	1.771e-30	%
Sma3	Metabolic pathways	01100	1.771e-30	%
Sma3	Biosynthesis of secondary metabolites	01110	1.771e-30	%

Source	Gene names
Sma3	4CL2; 4CLL2; 4CLL3; 4CLL4; 4CLL5; 4CLL6; 4CLL7; 4CLL8; ACLL15; ACLL20; At1g20480; At1g20490; At1g20500; At1g20510; At5g38120; B1065G12.10; B1065G12.9; F5M15.17; F5M15.18; F5M15.29; F5M15.30; GSVIVT00015553001; GSVIVT00015554001; GSVIVT00017901001; GSVIVT0

Source	GOs	Term	Type	Identity
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	4-coumarate-CoA ligase activity	GO:0016207	Molecular Function	-
Sma3	ligase activity	GO:0016874	Molecular Function	-
Sma3	metabolic process	GO:0008152	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	0.0	-
Sma3	AMP-dependent synthetase/ligase	IPR000873	-	0.0	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G20510.1	OPCL1 OPC-8:0 CoA ligase1 chr1:7103645-7105856 REVERSE LENGTH=546	5.0e-22	82%
RefSeq	Arabidopsis thaliana	NP_973872.1	OPC-8:0 CoA ligase1 [Arabidopsis thaliana]	4.0e-22	82%
RefSeq	Populus trichocarpa	XP_002334423.1	predicted protein, partial [Populus trichocarpa]	7.0e-24	80%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ABX8

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 84 aas, your sequence is shorter than subject: 47 - 373

Fln protein: NPEATSSTLDSDGWLRTGDLCYIDEEGYIFVVDRLKELIKYMGYQS*

Protein Length: 48

Fln nts: CAATCCGGAAGCGACTAGTTCAACTCTGGATTCGGATGGTTGGCTACGAACAGGCGATCTCTGTTACATTGATGAAGAAGGCTACATCTTTGTAGTGGACAGATTGAAAGAGCTTATCAAATATATGGGTTACCAGTCATAATCTGCATCTCTTTGAGAAGTCTCTTAACTTGTTGATGT

Fln Alignment:

GDTE5QK01BUO0T___NPEATSSTLDSDGWLRTGDLCYIDEEGYIFVVDRLKELIKYMGYQS*SASL
D5ABX8_______________NPEATASALDKDGWLRTGDLCYIDDNGYLFVVDRLKELIKYKGYQVAPAEL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain