|
||||||
|
UniGene Name: sp_v3.0_unigene81044
Length: 167 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81044
G |
|
Ace file of the UniGene sp_v3.0_unigene81044 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os08g0201700 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q0J7D6_ORYSJ | - | - | 4.0e-13 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 4.817e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 9.826e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G07650; AT1G53430; AT1G53440; AT1G56145; AT3G14840; At1g56140; At1g56145; F14G9.24; F1N18.20; F1N18.22; F24B9.29; GSVIVT00010175001; GSVIVT00010987001; GSVIVT00010990001; GSVIVT00013440001; GSVIVT00018818001; GSVIVT00027872001; GSVIVT00027874001; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G14840.2 | - | 2.0e-15 | 70% |
| RefSeq | Arabidopsis thaliana | NP_188102.5 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 2.0e-15 | 70% |
| RefSeq | Populus trichocarpa | XP_002339083.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWR4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 269 aas, your sequence is shorter than subject: 55 - 402
Fln protein:
W
Protein Length:
56
Fln nts:
G
Fln Alignment:
GDTE5QK01E1UER___RQGKREFINEVAVISELQHRNLVKLHGCCLEADDPLLVYEYLE
A9NWR4_______________KQGVKEFLTEIATISDVQHENLVKLHGCCAEEEHRILVYEYLE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
