UniGene Name: sp_v3.0_unigene80989
Length: 226 nt
![]() |
---|
>sp_v3.0_unigene80989
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Receptor serine/threonine kinase, putative n=1 Tax=Ricinus communis RepID=B9RIJ3_RICCO | - | - | 2.0e-19 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
Sma3 | Putative rust resistance kinase Lr10 | - | - | 1.125e-40 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 7.67e-07 | - |
Source | Gene names |
---|---|
Sma3 | 8ARK2; ARK1AS; AT4g18250; At5g38260; GSVIVT00004127001; GSVIVT00004129001; GSVIVT00004959001; GSVIVT00004961001; GSVIVT00004966001; GSVIVT00005129001; GSVIVT00005131001; GSVIVT00005228001; GSVIVT00005229001; GSVIVT00005230001; GSVIVT00005232001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18250.1 | receptor serine/threonine kinase, putative chr4:10087343-10091963 REVERSE LENGTH=853 | 1.0e-20 | 60% |
RefSeq | Arabidopsis thaliana | NP_193559.2 | putative receptor serine/threonine kinase [Arabidopsis thaliana] | 2.0e-20 | 60% |
RefSeq | Populus trichocarpa | XP_002334500.1 | predicted protein [Populus trichocarpa] | 5.0e-25 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRI9
Fln msg: Distance to subject end: 207 aas, your sequence is shorter than subject: 75 - 656
Fln protein:
R
Protein Length:
76
Fln nts:
G
Fln Alignment:
GDTE5QK01AUEJR___KPHNILLDSDFTPKVSDFGLAKLCGKEDDHISMTAGRGTPGYVAPELCDGDMGPVTDKSDVYSFGM
C0PRI9_______________KASNILLDSNFEAKVADFGLAKLASEDFTHVS-TRVMGTFGYLAPEYASS--GKLTDRSDVFSFGV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain