UniGene Name: sp_v3.0_unigene80978
Length: 178 nt
![]() |
---|
>sp_v3.0_unigene80978
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cysteine proteinase Mir3 n=3 Tax=Zea mays RepID=O22500_MAIZE | - | - | 2.0e-09 | 100% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
Sma3 | Cysteine protease | - | - | 7.28e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 7.574e-10 | - |
Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Cysteine endopeptidases. | EC:3.4.22.- | - | 3.486e-23 | - |
Source | Gene names |
---|---|
Sma3 | At1g09850; At1g20850; At1g47128; At3g19390; At3g19400; At3g19400/MLD14.12; At4g35350; At4g36880; At5g43060; At5g43060/MMG4.7; BoCP3; BrCP3; C14; C7A10.480; CP1; CP2; CP3; CP7; CPRF; CPRZ; CYSEP; DC-CP2; DCCP1; DcCysP1; DcCysP3; DcCysP4; DcCysP5; DcCysP6; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | cytoplasmic vesicle | GO:0031410 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | cysteine-type endopeptidase activity | GO:0004197 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | developmental programmed cell death | GO:0010623 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anaphylatoxin/fibulin | IPR000020 | - | 0.0 | - |
Sma3 | Granulin | IPR000118 | - | 0.0 | - |
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain C-terminal | IPR000668 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Phospholipase A2, active site | IPR013090 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain | IPR013128 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I29, cathepsin propeptide | IPR013201 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | IPR018069 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09850.1 | XBCP3 xylem bark cysteine peptidase 3 chr1:3201848-3203875 FORWARD LENGTH=437 | 5.0e-15 | 84% |
RefSeq | Arabidopsis thaliana | NP_563855.1 | xylem bark cysteine peptidase 3 [Arabidopsis thaliana] | 7.0e-15 | 84% |
RefSeq | Populus trichocarpa | XP_002307688.1 | predicted protein [Populus trichocarpa] | 2.0e-13 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW12
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 121 and 117, Distance to subject end: 84 aas, your sequence is shorter than subject: 59 - 294
Fln protein:
L
Protein Length:
60
Fln nts:
G
Fln Alignment:
GDTE5QK01DWSE4___GGREGINQIVTGDLISLSEQELVDCDTSYNQGCDAGLMDYAFEFIINNGGLDS
A9NW12_______________GAIEGINKIVTGSLVSLSEQELCDCDTSYNSGCDGGLMDYAFQWVIVNGGIDT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain