UniGene Name: sp_v3.0_unigene80965
Length: 220 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene80965
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP synthase subunit beta (Fragment) n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NEG5_COPC7 | - | - | 1.0e-32 | 98% |
FL-Next | sp=ATP synthase subunit beta; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | ATP synthase subunit beta, mitochondrial | - | - | 4.379e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | H(+)-transporting two-sector ATPase. | EC:3.6.3.14 | - | 1.527e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidative phosphorylation | 00190 | 1.527e-10 | % | |
Sma3 | Photosynthesis | 00195 | 1.527e-10 | % | |
Sma3 | Methane metabolism | 00680 | 1.527e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 1.527e-10 | % |
Source | Gene names |
---|---|
Sma3 | ATP2; ATPB; At5g08670; At5g08670/T2K12_20; At5g08680; At5g08690; At5g08690/T2K12_40; AtpB; CHLREDRAFT_78348; F1 ATPase; GSVIVT00017772001; GSVIVT00030440001; MICPUCDRAFT_49420; MICPUN_107337; OSTLU_119590; Os01g0685800; Os05g0553000; OsI_20905; OsJ_03042; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrial proton-transporting ATP synthase complex, catalytic core F(1) | GO:0000275 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting two-sector ATPase complex, catalytic domain | GO:0033178 | Cellular Component | 0.0 | - |
Sma3 | proton-transporting ATP synthase complex, catalytic core F(1) | GO:0045261 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | hydrogen-exporting ATPase activity, phosphorylative mechanism | GO:0008553 | Molecular Function | 0.0 | - |
Sma3 | hydrogen ion transporting ATP synthase activity, rotational mechanism | GO:0046933 | Molecular Function | 0.0 | - |
Sma3 | proton-transporting ATPase activity, rotational mechanism | GO:0046961 | Molecular Function | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Sma3 | plasma membrane ATP synthesis coupled proton transport | GO:0042777 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal | IPR004100 | - | 0.0 | - |
Sma3 | ATPase, F1 complex, beta subunit | IPR005722 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G08690.1 | ATP synthase alpha/beta family protein chr5:2825739-2828352 FORWARD LENGTH=556 | 1.0e-29 | 73% |
RefSeq | Arabidopsis thaliana | NP_568204.1 | ATP synthase subunit beta-2 [Arabidopsis thaliana] | 1.0e-29 | 73% |
RefSeq | Populus trichocarpa | XP_002315902.1 | mitochondrial beta subunit of F1 ATP synthase [Populus trichocarpa] | 1.0e-29 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUR7
Fln msg: Distance to subject end: 44 aas, your sequence is shorter than subject: 73 - 568
Fln protein:
Q
Protein Length:
74
Fln nts:
T
Fln Alignment:
GDTE5QK01D3XC9___QEHYEVATAVQKILQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFQVAQVFTGYEGKLVSLKDT
A9NUR7_______________EDHYNTARGVQKVLQNYKNLQDIIAILGMDELSEDDKLTVSRARKIQRFLSQPFHVAEVFTGAPGKYVDLKES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain