UniGene Name: sp_v3.0_unigene80950
Length: 239 nt
![]() |
---|
>sp_v3.0_unigene80950
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase, putative n=1 Tax=Ricinus communis RepID=B9SDY6_RICCO | - | - | 4.0e-27 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Putative receptor-type protein kinase LRK1 | - | - | 4.358e-27 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 1.5e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT4g02410; AT4g02420; AT4g04960; AT4g29050; At1g15530; At1g70110; At1g70130; At2g32800; At2g32800/F24L7.6; At2g37710; At3g08870; At3g45430; At3g53810; At4g02410; At4g02420; At4g04960; At4g29050; At5g01540; At5g01550; At5g01560; At5g03140; At5g59260; B1008 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - | |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Legume lectin, alpha chain, conserved site | IPR000985 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | IPR001899 | - | 0.0 | - | |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb7, N-terminal | IPR005576 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G53810.1 | Concanavalin A-like lectin protein kinase family protein chr3:19933153-19935186 REVERSE LENGTH=677 | 3.0e-32 | 63% |
RefSeq | Arabidopsis thaliana | NP_190949.1 | concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana] | 4.0e-32 | 63% |
RefSeq | Populus trichocarpa | XP_002309078.1 | predicted protein [Populus trichocarpa] | 7.0e-34 | 63% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVC0
Fln msg: Distance to subject end: 144 aas, your sequence is shorter than subject: 79 - 636
Fln protein:
L
Protein Length:
80
Fln nts:
A
Fln Alignment:
GDTE5QK01BULG9___LQGWCRRHTQLFIVYDYMPNGSLDKFIYENPTTVLSWHRRYAILKGVAAGMLYLHEQWEKRVIHRDIKSSNVLLDSELN
A9NVC0_______________LRGWCRRHTQLFIVYDYMPNGSLDKLIFGNPTTVLPWHRRYAILKGVAAGLLYLHEQWEKRVVHRDIKSSNVLLDSELN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain