|
||||||
|
UniGene Name: sp_v3.0_unigene80926
Length: 184 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80926
T |
|
Ace file of the UniGene sp_v3.0_unigene80926
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ethylene receptor homolog n=2 Tax=Physcomitrella patens RepID=A9CPF5_9BRYO | - | - | 4.0e-17 | 75% |
| FL-Next | sp=Ethylene receptor 2; Pelargonium hortorum (Common geranium). | - | - | 0.0 | 59% |
| Sma3 | Ethylene receptor homolog | - | - | 3.329e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | DETR1a; DETR1b; ETR; ETR1; ETR1a; ETR1b; ETR2; ETR3; ETR4; ETR6; ETR7; GSVIVT00000993001; PHYPADRAFT_173828; PHYPADRAFT_188161; PHYPADRAFT_192265; PHYPADRAFT_209543; PHYPADRAFT_67549; POPTRDRAFT_740887; PPETR1; RCOM_0333030; VITISV_002135; etr; etr1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | two-component response regulator activity | GO:0000156 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Signal transduction response regulator, receiver domain | IPR001789 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase-related protein, C-terminal | IPR004358 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, hybrid-type, ethylene sensor | IPR014525 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G66340.1 | ETR1, EIN1, ETR, AtETR1 Signal transduction histidine kinase, hybrid-type, ethylene sensor chr1:24734698-24737366 FORWARD LENGTH=738 | 3.0e-15 | 53% |
| RefSeq | Arabidopsis thaliana | NP_176808.3 | ethylene receptor 1 [Arabidopsis thaliana] | 4.0e-15 | 53% |
| RefSeq | Populus trichocarpa | XP_002327419.1 | ethylene receptor 4 [Populus trichocarpa] | 2.0e-15 | 59% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9XH57
Fln msg: Distance to subject end: 45 aas, your sequence is shorter than subject: 61 - 741
Fln protein:
C
Protein Length:
62
Fln nts:
T
Fln Alignment:
GDTE5QK01C23L1___CDVTVVDSGHECLQAMSPGQNFKVLFLDVCMPGMDGYEVAIHIQEMFPSRHERPLLVALTG
Q9XH57_______________CDVTTVSSSDELLRVVS--QDYKVVFMDVCMPEVDGFEIAVRIHEKFMTRHERPLIVALTG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
