|
||||||
|
UniGene Name: sp_v3.0_unigene80922
Length: 227 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80922
G |
|
Ace file of the UniGene sp_v3.0_unigene80922
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 6-phosphogluconate dehydrogenase, decarboxylating n=1 Tax=Tuber melanosporum Mel28 RepID=D5GBY0_TUBMM | - | - | 2.0e-34 | 97% |
| FL-Next | sp=6-phosphogluconate dehydrogenase, decarboxylating; Pinus sylvestris (Scots pine). | - | - | 0.0 | 56% |
| Sma3 | 6-phosphogluconate dehydrogenase, decarboxylating | - | - | 1.20372e-42 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphogluconate dehydrogenase (decarboxylating). | EC:1.1.1.44 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose phosphate pathway | 00030 | 0.0 | % | |
| Sma3 | Glutathione metabolism | 00480 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | 6PGDH; At1g64190; At5g41670; GSVIVT00002492001; GSVIVT00021207001; Os06g0111500; OsI_21345; OsJ_19864; P0029D06.14-1; P0029D06.14-2; POPTRDRAFT_640402; POPTRDRAFT_656743; POPTRDRAFT_831203; POPTRDRAFT_831204; POPTRDRAFT_837012; RCOM_0876630; RCOM_0901440; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | phosphogluconate dehydrogenase (decarboxylating) activity | GO:0004616 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | pentose-phosphate shunt | GO:0006098 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 6-phosphogluconate dehydrogenase, decarboxylating | IPR006113 | - | 0.0 | - |
| Sma3 | 6-phosphogluconate dehydrogenase, C-terminal | IPR006114 | - | 0.0 | - |
| Sma3 | 6-phosphogluconate dehydrogenase, NADP-binding | IPR006115 | - | 0.0 | - |
| Sma3 | IPR006183 | - | 0.0 | - | |
| Sma3 | 6-phosphogluconate-binding site | IPR006184 | - | 0.0 | - |
| Sma3 | Fibritin/6-phosphogluconate dehydrogenase, C-terminal extension | IPR012284 | - | 0.0 | - |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G64190.1 | 6-phosphogluconate dehydrogenase family protein chr1:23825549-23827012 REVERSE LENGTH=487 | 4.0e-19 | 54% |
| RefSeq | Arabidopsis thaliana | NP_176601.1 | 6-phosphogluconate dehydrogenase [Arabidopsis thaliana] | 5.0e-19 | 54% |
| RefSeq | Populus trichocarpa | XP_002329247.1 | predicted protein [Populus trichocarpa] | 5.0e-19 | 59% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E3V1K4
Fln msg: Distance to subject end: 85 aas, your sequence is shorter than subject: 75 - 483
Fln protein:
E
Protein Length:
76
Fln nts:
G
Fln Alignment:
GDTE5QK01CNB3C___IADLEQALYASKIISYAQGFMLIREAAKEYKWKLNNPAIALMWRGGCIIRSVFLADITKAYRAEPDLENLL
E3V1K4_______________IDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRIKKAYDRNPDLFNLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
