|
||||||
|
UniGene Name: sp_v3.0_unigene80913
Length: 138 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80913
G |
|
Ace file of the UniGene sp_v3.0_unigene80913 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Respiratory burst oxidase protein 1 (Fragment) n=1 Tax=Picea abies RepID=E9N9T3_PICAB | - | - | 5.0e-18 | 93% |
| FL-Next | sp=Respiratory burst oxidase homolog protein B; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 79% |
| Sma3 | Respiratory burst oxidase, putative | - | - | 5.213e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidoreductases, Acting on a peroxide as acceptor, Peroxidases. | EC:1.11.1.- | - | 1.44e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 1.44e-08 | % | |
| Sma3 | Oxidoreductases, Acting on NADH or NADPH, With a oxygen as acceptor. | EC:1.6.3.- | - | 5.415e-09 | - |
| Sma3 | NAD(P)H oxidase. | EC:1.6.3.1 | - | 6.768e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g47910; B1164G11.26; GSVIVT00006233001; GSVIVT00006235001; GSVIVT00022728001; LOC_Os11g33120; LOC_Os12g35610; MCA23.25; MtrDRAFT_AC154391g18v2; NbrbohB; Os01g0360200; Os12g0541300; OsI_01895; OsI_36373; OsI_38619; OsJ_01746; OsJ_36390; POPTRDRAFT_54813 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | NAD(P)H oxidase activity | GO:0016174 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor | GO:0050664 | Molecular Function | 0.0 | - |
| Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of programmed cell death | GO:0043069 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome b245, heavy chain | IPR000778 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | FAD-binding 8 | IPR013112 | - | 0.0 | - |
| Sma3 | Ferric reductase, NAD binding | IPR013121 | - | 0.0 | - |
| Sma3 | Flavoprotein transmembrane component | IPR013130 | - | 0.0 | - |
| Sma3 | NADPH oxidase Respiratory burst | IPR013623 | - | 0.0 | - |
| Sma3 | Ferredoxin reductase-type FAD-binding domain | IPR017927 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G47910.1 | RBOHD, ATRBOHD respiratory burst oxidase homologue D chr5:19397585-19401768 FORWARD LENGTH=921 | 2.0e-16 | 68% |
| RefSeq | Arabidopsis thaliana | NP_199602.1 | respiratory burst oxidase-D [Arabidopsis thaliana] | 2.0e-16 | 68% |
| RefSeq | Populus trichocarpa | XP_002303736.1 | predicted protein [Populus trichocarpa] | 3.0e-17 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q5ZAJ0
Fln msg: Distance to subject end: 383 aas, your sequence is shorter than subject: 45 - 905
Fln protein:
Q
Protein Length:
46
Fln nts:
G
Fln Alignment:
GDTE5QK01CH97K___FFGHNRPPN-WWFVKGVEGVTGVIMVVFMAIAFVLATPWFRRNK
Q5ZAJ0_______________FFGEKRPPNYWWFVKGTEGWTGVVMVVLMAIAFTLAQPWFRRNK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
