|
||||||
|
UniGene Name: sp_v3.0_unigene80861
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80861
G |
|
Ace file of the UniGene sp_v3.0_unigene80861
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | alpha-mannosidase [Arabidopsis thaliana] emb|CAA66821.1| alpha-mannosidase [Arabidopsis thaliana] emb|CAA72432.1| alpha-mannosidase precursor [Arabidopsis thaliana] dbj|BAB01735.1| alpha-mannosidase [Arabidopsis thaliana] gb|AAK62592.1| AT3g26720/MLJ15_12 | - | - | 1.0e-25 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 67% |
| Sma3 | Alpha-mannosidase | - | - | 1.707e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alpha-mannosidase. | EC:3.2.1.24 | - | 2.061e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Other glycan degradation | 00511 | 2.061e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | AMA1; AT3G26720; At3g26720; At5g13980; At5g66150; GSVIVT00017734001; GSVIVT00036759001; GSVIVT00037952001; GSVIVT00037953001; LOC_Os10g05069; LOC_Os11g32260; OSJNAa0029P06.4; OSJNBa0029P06.15; Os10g0140200; Os11g0525600; OsI_32713; OsI_36309; OsJ_30682; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 38, core | IPR000602 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolases 38, C-terminal | IPR011682 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolase, family 13, all-beta | IPR013780 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 38, central domain | IPR015341 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G26720.1 | Glycosyl hydrolase family 38 protein chr3:9816707-9823056 FORWARD LENGTH=1019 | 6.0e-28 | 67% |
| RefSeq | Arabidopsis thaliana | NP_189306.1 | alpha-mannosidase [Arabidopsis thaliana] | 8.0e-28 | 67% |
| RefSeq | Populus trichocarpa | XP_002321075.1 | predicted protein [Populus trichocarpa] | 4.0e-28 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7SVH7
Fln msg: Overlapping hits, possible frame ERROR between 178 and 160, Distance to subject end: 853 aas, your sequence is shorter than subject: 79 - 1025
Fln protein:
G
Protein Length:
80
Fln nts:
G
Fln Alignment:
GDTE5QK01BSYV0___FFVRWWREQNNKKKKIVRRLVASGQLEFINGGYVMHDEAATLYVDMIDQTTLxxxxxxREFGIVPRIGWQVDPFGHSA
D7SVH7_______________FFQRWWRDQSETVQGIVKQLVRSGQLEFINGGMCMHDEAATHYIDMVDQTTLxxxxxxKEFGVTPRIGWQIDPFGHSA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
