UniGene Name: sp_v3.0_unigene80822
Length: 195 nt
UniGene Fasta |
---|
>sp_v3.0_unigene80822
A |
Ace file of the UniGene sp_v3.0_unigene80822 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Fructose-bisphosphate aldolase n=1 Tax=Picea sitchensis RepID=B8LMQ9_PICSI | - | - | 2.0e-07 | 75% |
FL-Next | sp=Fructose-bisphosphate aldolase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | Fructose-bisphosphate aldolase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase. | EC:4.1.2.13 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Pentose phosphate pathway | 00030 | 0.0 | % | |
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ALDP; Aldp; At2g01140; At2g21330; At4g38970; F10A8.2; F19H22.70; F3K23.9; FBA1; FBA2; FBA3; GSVIVT00030426001; GSVIVT00035963001; GSVIVT00036826001; LOC_Os11g07020; NpAldP1; Os01g0118000; Os11g0171300; OsI_00149; OsI_35277; OsJ_00159; P0494A10.15; PHYPADR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | plastoglobule | GO:0010287 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | fructose-bisphosphate aldolase activity | GO:0004332 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase, class-I | IPR000741 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: B8LMQ9
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 63 - 257
Fln protein:
P
Protein Length:
64
Fln nts:
A
Fln Alignment:
GDTE5QK01DEHH1___AAQRALLIRAKANSLAQLGRYSAXXXXXXXXXXMFVKGYTY
B8LMQ9_______________AAQRALLIRAKANSLAQLGRYSAEGESEESKKGMFVKGYTY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain