|
||||||
|
UniGene Name: sp_v3.0_unigene80816
Length: 154 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80816
A |
|
Ace file of the UniGene sp_v3.0_unigene80816 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glutathione reductase, gro-2 n=1 Tax=Thalassiosira pseudonana RepID=B8CEG9_THAPS | - | - | 3.0e-11 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | Glutathione reductase | - | - | 2.17e-38 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferred entry: 1.8.1.7. | EC:1.6.4.2 | - | 1.316e-12 | - |
| Sma3 | Glutathione-disulfide reductase. | EC:1.8.1.7 | - | 5.324e-29 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 5.324e-29 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g24170; CHLREDRAFT_134165; DMAS1; DMAS2; GOR; GOR1; GR; GR-5; GR1; GR2; GRC2; GSHR1; GSR1; GSVIVT00020491001; Gr; Gsr_2; HvGR2; LOC_Os02g56850; LOC_Os03g06740; MICPUN_91929; MUJ8.7; OJ1123F12.19; OJ1293_E04.4-1; OJ1607A12.5; OSJNBa0053L11.26-1; OSTLU_2 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | glutathione-disulfide reductase activity | GO:0004362 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | glutathione metabolic process | GO:0006749 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mercuric reductase | IPR000815 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
| Sma3 | Glutathione reductase, eukaryote/bacterial | IPR006322 | - | 0.0 | - |
| Sma3 | Glutathione-disulphide reductase | IPR006324 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G54660.1 | GR, EMB2360, ATGR2 glutathione reductase chr3:20230356-20233100 REVERSE LENGTH=565 | 2.0e-11 | 61% |
| RefSeq | Arabidopsis thaliana | NP_191026.1 | glutathione reductase [Arabidopsis thaliana] | 3.0e-11 | 61% |
| RefSeq | Populus trichocarpa | XP_002321515.1 | glutathione reductase [Populus trichocarpa] | 4.0e-12 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LRK1
Fln msg: your sequence is shorter than subject: 50 - 492
Fln protein:
I
Protein Length:
51
Fln nts:
A
Fln Alignment:
GDTE5QK01EOXMJ___IQGFAVALKAGATKDVFDDTIGIHPTSAEEFVTMRT
B8LRK1_______________MQGIAVALKCGATKAQFDSTVGIHPSAAEEFVTMRT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
