|
||||||
|
UniGene Name: sp_v3.0_unigene80794
Length: 239 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80794
T |
|
Ace file of the UniGene sp_v3.0_unigene80794
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ADP-ribosylation factor-like protein [Panax ginseng] | - | - | 5.0e-26 | 90% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | ADP-ribosylation factor | - | - | 9.603e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARF; ARF1; ARF2-A; ARF2-B; ARF3; ARFA1-A; ARFA1-D; ARFA1A; ARFA1B; ARFA2-A; ARFA2-B; AT3G62290; Arf; Arf1; ArfA11; ArfA12; ArfA13; ArfA14; ArfA15; At1g10630; At1g23490; At1g70490; At3g62290; At5g14670; CHLREDRAFT_186126; CHLREDRAFT_2332; F24J13.6; F28C11. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | endosome | GO:0005768 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | IPR006688 | - | 0.0 | - | |
| Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G62290.1 | ATARFA1E, ARFA1E ADP-ribosylation factor A1E chr3:23052287-23053545 FORWARD LENGTH=181 | 8.0e-35 | 90% |
| RefSeq | Arabidopsis thaliana | NP_001190162.1 | ADP-ribosylation factor A1E [Arabidopsis thaliana] | 1.0e-34 | 90% |
| RefSeq | Populus trichocarpa | XP_002320274.1 | predicted protein [Populus trichocarpa] | 1.0e-34 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PPL2
Fln msg: your sequence is shorter than subject: 71 - 181
Fln protein:
C
Protein Length:
72
Fln nts:
T
Fln Alignment:
GDTE5QK01AI8F3___ILLICEHKQYLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
C0PPL2_______________VLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
