UniGene Name: sp_v3.0_unigene80762
Length: 206 nt
![]() |
---|
>sp_v3.0_unigene80762
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase, putative n=1 Tax=Ricinus communis RepID=B9SPH6_RICCO | - | - | 6.0e-20 | 67% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Chromosome undetermined scaffold_302, whole genome shotgun sequence | - | - | 1.615e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.923e-06 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 1.9e-17 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.082e-06 | - |
Source | Gene names |
---|---|
Sma3 | 24K23.9; Ark1; At1g61390; At1g61610; At1g65790; At1g65800; At1g70520; At4g04490; At4g04500; At4g04540; At4g04570; At4g11490; At4g21410; At4g23190; At4g23310; At4g38830; B1070A12.4; CRK11; CRK2; CRK23; CRK26; CRK29; CRK33; CRK36; CRK37; CRK39; CRK40; F16G2 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70520.1 | CRK2 cysteine-rich RLK (RECEPTOR-like protein kinase) 2 chr1:26584888-26587334 REVERSE LENGTH=649 | 3.0e-25 | 66% |
RefSeq | Arabidopsis thaliana | NP_177209.1 | cysteine-rich receptor-like protein kinase 2 [Arabidopsis thaliana] | 5.0e-25 | 66% |
RefSeq | Populus trichocarpa | XP_002300041.1 | predicted protein [Populus trichocarpa] | 3.0e-25 | 64% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ5
Fln msg: Distance to subject end: 27 aas, your sequence is shorter than subject: 68 - 505
Fln protein:
Y
Protein Length:
69
Fln nts:
T
Fln Alignment:
GDTE5QK01BFUAR___YEYLHNSSLDKFIFDTTKAHSLIWRKRYEIIVGTARGLAYLHEESQIRIIHRDIKASNILLDNKHRPK
B8LLJ5_______________YEYLQNSSLDKIIFDITKRHLLDWRERYEIIVGTARGLAYLHEESEIRIIHRDIKASNILLDNKYRPK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain