UniGene Name: sp_v3.0_unigene80684
Length: 111 nt
UniGene Fasta |
---|
>sp_v3.0_unigene80684
A |
Ace file of the UniGene sp_v3.0_unigene80684 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cellulose synthase-like protein D2 [Arabidopsis thaliana] sp|Q9LFL0.1|CSLD2_ARATH RecName: Full=Cellulose synthase-like protein D2; Short=AtCslD2 emb|CAC01704.1| cellulose synthase catalytic subunit-like protein [Arabidopsis thaliana] gb|AED92357.1| cellu | - | - | 2.0e-13 | 91% |
FL-Next | tr=Cellulose synthase catalytic subunit; Pinus radiata (Monterey pine) (Pinus insignis). | - | - | 0.0 | 70% |
Sma3 | Cellulose synthase-like protein D4 | - | - | 5.347e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.82e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 8.281e-18 | % |
Source | Gene names |
---|---|
Sma3 | ATHB; At1g02730; At1g32180; At2g33100; At3g03050; At4g38190; At5g05170; At5g16910; CESA3; CEV1; CSLD1; CSLD2; CSLD3; CSLD4; CSLD5; CSLD6; CesA1; CslD1; ELI1; F20D10.310; F22D16.26; F25I18.16; F2K13.60; F3C3.4; GSVIVT00014029001; GSVIVT00015671001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
Sma3 | 1,4-beta-D-xylan synthase activity | GO:0047517 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | cell wall biogenesis | GO:0042546 | Biological Process | 0.0 | - |
Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G16910.1 | ATCSLD2, CSLD2 cellulose-synthase like D2 chr5:5561679-5565290 FORWARD LENGTH=1145 | 2.0e-18 | 91% |
RefSeq | Arabidopsis thaliana | NP_197193.1 | cellulose synthase-like protein D2 [Arabidopsis thaliana] | 3.0e-18 | 91% |
RefSeq | Populus trichocarpa | XP_002303441.1 | predicted protein [Populus trichocarpa] | 1.0e-18 | 91% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q6GUG6
Fln msg: Distance to subject end: 480 aas, your sequence is shorter than subject: 36 - 1084
Fln protein:
F
Protein Length:
37
Fln nts:
A
Fln Alignment:
GDTE5QK01CN5T9___FILNLDCDHYIYNSEALREGICFMMD-RGGDGICYVQ
Q6GUG6_______________FMLNLDCDHYINNSKAIREGMCFMMDPQVGRKVCYVQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain