UniGene Name: sp_v3.0_unigene80651
Length: 213 nt
![]() |
---|
>sp_v3.0_unigene80651
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cellulose synthase 5, glycosyltransferase family 2 n=3 Tax=Physcomitrella patens RepID=A9RUW7_PHYPA | - | - | 5.0e-14 | 60% |
FL-Next | tr=Cellulose synthase catalytic subunit; Pinus taeda (Loblolly pine). | - | - | 0.0 | 58% |
Sma3 | Cellulose synthase | - | - | 9.105e-29 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cellulose synthase (UDP-forming). | EC:2.4.1.12 | - | 1.263e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 1.263e-09 | % |
Source | Gene names |
---|---|
Sma3 | At4g18780; At5g17420; CESA4; CESA7; CESA8; CesA; CesA-4; CesA-9; CesA1; CesA10; CesA2; CesA3; CesA4; CesA5; CesA6; CesA7; CesA8; F28A21.190; FRA5; GSVIVT00002977001; GSVIVT00025577001; GSVIVT00035840001; GSVIVT00036318001; IRX1; IRX3; LEW2; OsI_03742; OsJ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | positive regulation of abscisic acid biosynthetic process | GO:0010116 | Biological Process | 0.0 | - |
Sma3 | rhamnogalacturonan I side chain metabolic process | GO:0010400 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | Gonadotropin, beta subunit, conserved site | IPR018245 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G17420.1 | IRX3, CESA7, ATCESA7, MUR10 Cellulose synthase family protein chr5:5736859-5741407 REVERSE LENGTH=1026 | 3.0e-18 | 56% |
RefSeq | Arabidopsis thaliana | NP_197244.1 | cellulose synthase A catalytic subunit 7 [UDP-forming] [Arabidopsis thaliana] | 4.0e-18 | 56% |
RefSeq | Populus trichocarpa | XP_002302169.1 | cellulose synthase [Populus trichocarpa] | 4.0e-18 | 56% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q5DI95
Fln msg: Distance to subject end: 236 aas, your sequence is shorter than subject: 70 - 984
Fln protein:
E
Protein Length:
71
Fln nts:
G
Fln Alignment:
GDTE5QK01DTVNM___VTEDLLTGLEMHCLGWRSIYFWPTRPAFKGVAPAIALDRLAQRKRISCGLVSVLLCRSSPLFYGF
Q5DI95_______________VTEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLHQVLRWALGSIEILFSRHCPLWYGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain