UniGene Name: sp_v3.0_unigene80574
Length: 177 nt
UniGene Fasta |
---|
>sp_v3.0_unigene80574
G |
Ace file of the UniGene sp_v3.0_unigene80574 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450 monooxygenase CYP736B n=3 Tax=Vitis RepID=C0KLZ0_9ROSI | - | - | 9.0e-05 | 51% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Sma3 | Cytochrome P450 | - | - | 2.674e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:1.14.-.- | - | 1.455e-09 | - |
Source | Gene names |
---|---|
Sma3 | Asp-3; At2g24180; At2g45560; At2g45580; At5g25120; At5g25130; CYP703A4; CYP71A10; CYP71A5; CYP71A9; CYP71AN2v1; CYP71AN3; CYP71AN4; CYP71AS13; CYP71B11; CYP71B12; CYP71B6; CYP736A3v1; CYP736A5v1; CYP75; CYP76B8; CYP76C1; CYP76C3; CYP76T2; CYP76T3; CYP76T5 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF247, plant | IPR004158 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQT9
Fln msg: Distance to subject end: 205 aas, your sequence is shorter than subject: 59 - 309
Fln protein:
G
Protein Length:
60
Fln nts:
G
Fln Alignment:
GDTE5QK01EEH26___NLHMLGKIPHRSLAALSMKYGPXXXXXXXXXXXXVVSSPEIASEF
B8LQT9_______________NLHMLGELPHRAMAALSMKYGPLMSLRLGPALAIVVSSPEIAREF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain