UniGene Name: sp_v3.0_unigene80561
Length: 217 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80561
C |
Ace file of the UniGene sp_v3.0_unigene80561 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Plasma membrane H+-ATPase n=1 Tax=Daucus carota RepID=Q75N98_DAUCA | - | - | 9.0e-18 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Plasma membrane H+-ATPase | - | - | 1.236e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Adenosinetriphosphatase. | EC:3.6.1.3 | - | 2.342e-14 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 2.342e-14 | % | |
| Sma3 | Transferred entry: 3.6.3.6. | EC:3.6.1.35 | - | 6.685e-28 | - |
| Sma3 | Proton-exporting ATPase. | EC:3.6.3.6 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AHA1; AHA2; AHA3; AHA5; AHA6; AHA8; AHA9; ATP1; Aa_42640; At1g80660; At2g07560; At2g18960; At2g24520; At3g42640; At4g11730; At4g30190; At5g57350; BHA-1; Cr_42640; DcPA 1; DcPA 2; DcPA 4; DcPA 5; F19F24.16; F23A5.1; F25P17.18; F9A16.7; F9N11.40; GSVIVT0000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen-exporting ATPase activity, phosphorylative mechanism | GO:0008553 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | proton transport | GO:0015992 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, plasma-membrane proton-efflux | IPR006534 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G30190.2 | - | 1.0e-21 | 76% |
| RefSeq | Arabidopsis thaliana | NP_194748.1 | H(+)-ATPase 2 [Arabidopsis thaliana] | 1.0e-21 | 76% |
| RefSeq | Populus trichocarpa | XP_002324397.1 | predicted protein [Populus trichocarpa] | 3.0e-22 | 77% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQS1
Fln msg: Distance to subject end: 887 aas, your sequence is shorter than subject: 64 - 955
Fln protein:
M
Protein Length:
65
Fln nts:
C
Fln Alignment:
GDTE5QK01DGF6D___LDDVKNETVDLERIPIDEVFEQLKCTRNGLTGDEGEKRLQIFGPNKLEEKR
B8LQS1_______________LEGIKNESVDLERIPIEEVFEQLRCTREGLTSNEGENRLQIFGFNKLEEKK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)