UniGene Name: sp_v3.0_unigene80470
Length: 212 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene80470
T |
Ace file of the UniGene sp_v3.0_unigene80470
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATPase AAA-2 domain protein n=1 Tax=Fibrobacter succinogenes subsp. succinogenes S85 RepID=C9RKR5_FIBSS | - | - | 4.0e-09 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Chaperone, Hsp100 family, clpb-type | - | - | 4.463e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g25140; At5g15450; CHLREDRAFT_172454; CHLREDRAFT_195417; CHLREDRAFT_195422; CHLREDRAFT_195423; CLPB1; CLPB2; CLPB3; CLPD1; GSVIVT00021042001; GSVIVT00032702001; GSVIVT00037940001; HSP101; LOC_Os03g31300; LOC_Os11g16770; Lehsp100/ClpB; MICPUCDRAFT_56397 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | nuclease activity | GO:0004518 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | nucleotide-excision repair | GO:0006289 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | chloroplast organization | GO:0009658 | Biological Process | 0.0 | - |
| Sma3 | protein metabolic process | GO:0019538 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chaperonin ClpA/B | IPR001270 | - | 0.0 | - |
| Sma3 | UVR domain | IPR001943 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | Clp, N-terminal | IPR004176 | - | 0.0 | - |
| Sma3 | ATPase, AAA-2 | IPR013093 | - | 0.0 | - |
| Sma3 | Chaperonin ClpB | IPR017730 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Chaperonin ClpA/B, conserved site | IPR018368 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G15450.1 | APG6, CLPB3, CLPB-P casein lytic proteinase B3 chr5:5014399-5018255 REVERSE LENGTH=968 | 9.0e-13 | 76% |
| RefSeq | Arabidopsis thaliana | NP_568314.1 | casein lytic proteinase B3 [Arabidopsis thaliana] | 1.0e-12 | 76% |
| RefSeq | Populus trichocarpa | XP_002324092.1 | predicted protein [Populus trichocarpa] | 1.0e-12 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5A8K5
Fln msg: Distance to subject end: 232 aas, your sequence is shorter than subject: 51 - 292
Fln protein:
M
Protein Length:
52
Fln nts:
T
Fln Alignment:
GDTE5QK01C2351___LAVHPLHSQHALVRIDMSEYMEKHAVSRLVGAPPGYVG
D5A8K5_______________LASYLFNTDEALVRIDMSEYMEKHAVSRLIGAPPGYVG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta