UniGene Name: sp_v3.0_unigene80396
Length: 105 nt
![]() |
---|
>sp_v3.0_unigene80396
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 9-cis epoxycarotenoid dioxygenase (Fragment) n=2 Tax=Oncidium Gower Ramsey RepID=Q52QS7_ONCHC | - | - | 9.0e-10 | 90% |
FL-Next | tr=Putative 9-cis-epoxycarotenoid dioxygenase; Taxodium distichum (Bald cypress) (Cupressus disticha). | - | - | 0.0 | 84% |
Sma3 | 9-cis-epoxycarotenoid dioxygenase | - | - | 1.854e-30 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 9-cis-epoxycarotenoid dioxygenase. | EC:1.13.11.51 | - | 1.057e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carotenoid biosynthesis | 00906 | 1.057e-14 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.057e-14 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.057e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 1.057e-14 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.057e-14 | % |
Source | Gene names |
---|---|
Sma3 | At1g30100; At1g78390; At3g14440; At4g18350; CitNCED3; CmNCED3a; CmNCED3b; F28J12.10; F3F9.10; GSVIVT00000988001; HvNCED1; HvNCED2; LOC_Os03g44380; LOC_Os12g42280; LsNCED2; MOA2.4; NCED; NCED1; NCED2; NCED3; NCED4; NCED5; NCED6; NCED7; NCED9; Os03g0645900; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | 9-cis-epoxycarotenoid dioxygenase activity | GO:0045549 | Molecular Function | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 0.0 | - |
Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carotenoid oxygenase | IPR004294 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G78390.1 | NCED9, ATNCED9 nine-cis-epoxycarotenoid dioxygenase 9 chr1:29490895-29492868 REVERSE LENGTH=657 | 7.0e-13 | 81% |
RefSeq | Arabidopsis thaliana | NP_177960.1 | 9-cis-epoxycarotenoid dioxygenase NCED9 [Arabidopsis thaliana] | 9.0e-13 | 81% |
RefSeq | Populus trichocarpa | XP_002316871.1 | predicted protein [Populus trichocarpa] | 5.0e-12 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q0EEH1
Fln msg: Distance to subject end: 282 aas, your sequence is shorter than subject: 35 - 631
Fln protein:
F
Protein Length:
36
Fln nts:
T
Fln Alignment:
GDTE5QK01CHXTU___FEGQLKSSMIAHPKIDPETGEMFALSYDVIKKP
Q0EEH1_______________FDGQLQSAMIAHPKIDPETKELFALSYDVIKKP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain