|
||||||
|
UniGene Name: sp_v3.0_unigene80354
Length: 220 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80354
T |
|
Ace file of the UniGene sp_v3.0_unigene80354 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Catalase n=1 Tax=Schizophyllum commune H4-8 RepID=D8PTL6_SCHCM | - | - | 3.0e-32 | 87% |
| FL-Next | sp=Catalase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 52% |
| Sma3 | Catalase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Catalase. | EC:1.11.1.6 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G20620; AT4G35090; At1g20620; At1g20630; At4g35090; At4g35090/M4E13.140; CAT; CAT-1; CAT1; CAT2; CAT3; CAT4; CATA; CATA2; CATB; CHLREDRAFT_150104; Cat1; Cat2; Cat3; CatC; F2D10.11; F2D10.40; F5M15.31; F5M15.5; GSVIVT00002880001; LOC_Os02g02400; LOC_Os0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | glyoxysome | GO:0009514 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | catalase activity | GO:0004096 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | cellular response to nitrogen starvation | GO:0006995 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | cellular response to sulfate starvation | GO:0009970 | Biological Process | 0.0 | - |
| Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Catalase haem-binding site | IPR002226 | - | 0.0 | - |
| Sma3 | Catalase immune-responsive domain | IPR010582 | - | 0.0 | - |
| Sma3 | Catalase core domain | IPR011614 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Catalase, mono-functional, haem-containing | IPR018028 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20630.1 | CAT1 catalase 1 chr1:7146812-7149609 FORWARD LENGTH=492 | 2.0e-24 | 61% |
| RefSeq | Arabidopsis thaliana | NP_564121.1 | catalase 1 [Arabidopsis thaliana] | 3.0e-24 | 61% |
| RefSeq | Populus trichocarpa | XP_002306976.1 | catalase [Populus trichocarpa] | 3.0e-24 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8YBE1
Fln msg: Distance to subject end: 144 aas, your sequence is shorter than subject: 73 - 492
Fln protein:
Q
Protein Length:
74
Fln nts:
T
Fln Alignment:
GD4IA4404ITHWG___EHNFDFDILDATKIWPQELVPLEEIGELVLNRVVDEFFPETEQVAFCTSHVVPGIGFSDDPLLQGRNFSY
B8YBE1_______________EDRYDFDPLDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
