UniGene Name: sp_v3.0_unigene80303
Length: 175 nt
![]() |
---|
>sp_v3.0_unigene80303
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Endoribonuclease Dicer homolog 2 n=2 Tax=Arabidopsis thaliana RepID=DCL2_ARATH | - | - | 2.0e-10 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
Sma3 | Dicer-like protein | - | - | 1.464e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease III. | EC:3.1.26.3 | - | 2.414e-10 | - |
Source | Gene names |
---|---|
Sma3 | At1g01040; At3g03300; CAF; DCL901; DCL903; DCL904; GSVIVT00025032001; GSVIVT00032302001; LOC_Os03g02970; LOC_Os10g34430; OJ1705B08.11; OSJNBa0029C15.23; Os03g0121800; Os10g0485600; OsI_09779; OsI_34085; OsJ_09217; OsJ_31945; PHYPADRAFT_234670; POPTRDRAFT_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nuclear dicing body | GO:0010445 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
Sma3 | primary miRNA processing | GO:0031053 | Biological Process | 0.0 | - |
Sma3 | mRNA cleavage involved in gene silencing by miRNA | GO:0035279 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Sma3 | Extracellular solute-binding protein, family 3, conserved site | IPR018313 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G03300.1 | DCL2, ATDCL2 dicer-like 2 chr3:768020-774833 REVERSE LENGTH=1388 | 9.0e-15 | 66% |
RefSeq | Arabidopsis thaliana | NP_001078101.1 | protein dicer-like 2 [Arabidopsis thaliana] | 1.0e-14 | 66% |
RefSeq | Populus trichocarpa | XP_002315119.1 | dicer-like protein [Populus trichocarpa] | 3.0e-13 | 66% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW09
Fln msg: Distance to subject end: 188 aas, your sequence is shorter than subject: 57 - 330
Fln protein:
W
Protein Length:
58
Fln nts:
C
Fln Alignment:
GD4IA4404H62AL___FQNKALLVEAITHASQQDPEGGCCYQRLEFLGDSVLDFLITQHLYSMH
A9NW09_______________FRVHTLVVESVTHASYKEPSFSGCYQRLEFLGDAVLDYLITLYFYKTY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain