|
||||||
|
UniGene Name: sp_v3.0_unigene80292
Length: 125 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80292
T |
|
Ace file of the UniGene sp_v3.0_unigene80292
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ethylene receptor (Fragment) n=1 Tax=Persea americana RepID=B0LSM7_PERAE | - | - | 2.0e-10 | 85% |
| FL-Next | sp=Protein EIN4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 82% |
| Sma3 | Ethylene receptor | - | - | 1.545e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | 46C02.6; At3g04580; At3g23150; BO-ETR2; CS-ETR2; CcEIN4; DkETR2; EIN4; ETR; ETR1; ETR2; ETR3; ETR4; ETR40; ETR5; ETR6; ETR7; ETR9; F7O18.5; GSVIVT00002180001; GSVIVT00020174001; NTHK1; NTHK2; OJ1119_A01.4-1; OJ1119_A01.4-2; OSJNBb0089K06.20; Os02g0820900; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | two-component response regulator activity | GO:0000156 | Molecular Function | 0.0 | - |
| Sma3 | GO:0004696 | Molecular Function | 0.0 | - | |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ethylene binding | GO:0051740 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of ethylene mediated signaling pathway | GO:0010105 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Signal transduction response regulator, receiver domain | IPR001789 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase-related protein, C-terminal | IPR004358 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, hybrid-type, ethylene sensor | IPR014525 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G04580.1 | EIN4 Signal transduction histidine kinase, hybrid-type, ethylene sensor chr3:1235576-1237965 REVERSE LENGTH=766 | 4.0e-13 | 82% |
| RefSeq | Arabidopsis thaliana | NP_187108.1 | protein EIN4 [Arabidopsis thaliana] | 5.0e-13 | 82% |
| RefSeq | Populus trichocarpa | XP_002311669.1 | ethylene receptor 5 [Populus trichocarpa] | 3.0e-13 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9ZTP3
Fln msg: Distance to subject end: 624 aas, your sequence is shorter than subject: 41 - 766
Fln protein:
Q
Protein Length:
42
Fln nts:
T
Fln Alignment:
GD4IA4404JDFZV___SFHVMLALTIFKFLTALVSCATAITLVTLIPELLRVKVRE
Q9ZTP3_______________SFQLMLWLTIFKFLTALVSCATAITLLTLIPLLLKWKVRE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
