UniGene Name: sp_v3.0_unigene80233
Length: 196 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene80233
T |
Ace file of the UniGene sp_v3.0_unigene80233 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | lectin protein kinase-like protein [Arabidopsis thaliana] sp|Q9XID3.1|Y1343_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300; Flags: Precursor gb|AAD39605.1|AC007454_4 Contains similarity to gi|479356 protein kin | - | - | 7.0e-27 | 89% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
Sma3 | S-receptor kinase, putative | - | - | 2.094e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.257e-06 | - |
Source | Gene names |
---|---|
Sma3 | 17L07.5; AT4g32300; At1g34300; At2g19130; At4g32300; B1099D03.46; B1099D03.51; B1423D04.25; DUPR11.18; F10M6.60; F23M19.5; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00003760001; GSVIVT00003762001; GSVIVT00016916001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G34300.1 | lectin protein kinase family protein chr1:12503450-12505939 FORWARD LENGTH=829 | 1.0e-33 | 89% |
RefSeq | Arabidopsis thaliana | NP_174690.1 | lectin protein kinase-like protein [Arabidopsis thaliana] | 2.0e-33 | 89% |
RefSeq | Populus trichocarpa | XP_002327224.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-34 | 90% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWR4
Fln msg: Distance to subject end: 272 aas, your sequence is shorter than subject: 65 - 402
Fln protein:
F
Protein Length:
66
Fln nts:
T
Fln Alignment:
GD4IA4404J09E5___FGTVYKGELLNKTIVAVKQLEG-IEQGERQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFM
A9NWR4_______________FGSVYKGTLKDGTVVAVKQLSAQSKQGVKEFLTEIATISDVQHENLVKLHGCCAEEEHRILVYEYL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain