UniGene Name: sp_v3.0_unigene80231
Length: 208 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene80231
G |
Ace file of the UniGene sp_v3.0_unigene80231
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Translation elongation factor 1-alpha (Fragment) n=3 Tax=Hypocreales RepID=A4U9K0_9HYPO | - | - | 5.0e-27 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Elongation factor 1-alpha | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | A1; A2; A3; A4; AT1G07930; AT1G07940; At1g07920; At1g07920/T6D22.2; At1g07930; At1g07940; At5g60390; EF-1-alpha; EF-1alpha; EF1A; MUF9.4; NpeEF1A; PHYPADRAFT_104509; PHYPADRAFT_158894; PHYPADRAFT_158916; PHYPADRAFT_163704; PHYPADRAFT_174589; PHYPADRAFT_18 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
| Sma3 | Translation elongation factor EFTu/EF1A, C-terminal | IPR004160 | - | 0.0 | - |
| Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
| Sma3 | Translation elongation factor EF1A, eukaryotic/archaeal | IPR004539 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, conserved site | IPR018483 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G60390.1 | GTP binding Elongation factor Tu family protein chr5:24289226-24290675 FORWARD LENGTH=449 | 2.0e-26 | 63% |
| RefSeq | Arabidopsis thaliana | NP_001030993.1 | Elongation factor 1-alpha [Arabidopsis thaliana] | 2.0e-26 | 63% |
| RefSeq | Populus trichocarpa | XP_002315286.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-27 | 63% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMD8
Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 69 - 167
Fln protein:
V
Protein Length:
70
Fln nts:
G
Fln Alignment:
GD4IA4404I7WVH___VVGDKTNDPPAGCADFTAQVIVLNHPGQIHAGYAPVLDCHTSHIACKFAEILSKVDKRTGKATEENPKF
B8LMD8_______________VASDSKNDPAREAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKVDRRSGKELEREPKF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta