|
||||||
|
UniGene Name: sp_v3.0_unigene80218
Length: 212 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80218
G |
|
Ace file of the UniGene sp_v3.0_unigene80218 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Serine/threonine-protein kinase NAK n=2 Tax=Zea mays RepID=B4FT29_MAIZE | - | - | 2.0e-19 | 69% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Protein kinase APK1B, chloroplast, putative | - | - | 2.789e-21 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.209e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABC1041; ACIK1; APK1B; APK2a; APK2b; ARSK1; At1g14370; At1g14370/F14L17.14; At1g61590; At2g02800; At2g02800/T20F6.6; At2g05940; At2g07180; At2g26290; At2g28930; At2g39660; At5g01020; At5g01020/F7J8_5; At5g15080; At5g15080/F2G14_200; At5g35580; B1144B06.39 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 8 | IPR002495 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G05940.1 | Protein kinase superfamily protein chr2:2287514-2289270 REVERSE LENGTH=462 | 3.0e-23 | 67% |
| RefSeq | Arabidopsis thaliana | NP_178651.1 | kinase-like protein [Arabidopsis thaliana] | 5.0e-23 | 67% |
| RefSeq | Populus trichocarpa | XP_002326125.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKU3
Fln msg: Distance to subject end: 291 aas, your sequence is shorter than subject: 70 - 440
Fln protein:
R
Protein Length:
71
Fln nts:
G
Fln Alignment:
GD4IA4404IIUYN___RQNSGSDLYVFTFNELKTITENFRVDYILGEGGFGKVYKGQIDEDLKPGLKAQPVAVKVLNPEGHQGHRE
B8LKU3_______________RQDSGSNVLVFTLFELEIITKSFRSDYILGEGGFGTVYKGYIDENVRAGLKPLPVAVKVLNKNGFQGHRE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
