UniGene Name: sp_v3.0_unigene80127
Length: 217 nt
![]() |
---|
>sp_v3.0_unigene80127
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chloroplast light-harvesting protein CP29 Lhcb4 n=1 Tax=Acetabularia acetabulum RepID=A4QPJ4_ACEAT | - | - | 8.0e-25 | 76% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
Sma3 | Chlorophyll A/B binding protein, putative | - | - | 4.59e-09 | - |
Source | Gene names |
---|---|
Sma3 | At2g40100; At3g08940; At4g10340; At5g01530; CBP3; CHLREDRAFT_184810; Cab9; CipCp29; F24G24.140; F27I1.2; F7A7_50; GSVIVT00021499001; GSVIVT00031964001; LHCB4; LHCB4.1; LHCB4.2; LHCB4.3; LHCB5; LOC_Os11g13890; Lhcb4; Lhcb4*1; Lhcb5; Lhcb5-1; Lhcb5-2; Lhcb8 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | thylakoid light-harvesting complex | GO:0009503 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | PSII associated light-harvesting complex II | GO:0009517 | Cellular Component | 0.0 | - |
Sma3 | photosystem I | GO:0009522 | Cellular Component | 0.0 | - |
Sma3 | photosystem II | GO:0009523 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | photosystem II antenna complex | GO:0009783 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | plastoglobule | GO:0010287 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | chlorophyll binding | GO:0016168 | Molecular Function | 0.0 | - |
Sma3 | photosynthesis, light harvesting | GO:0009765 | Biological Process | 0.0 | - |
Sma3 | nonphotochemical quenching | GO:0010196 | Biological Process | 0.0 | - |
Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Chlorophyll A-B binding protein, plant | IPR001344 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G40100.1 | LHCB4.3 light harvesting complex photosystem II chr2:16745884-16747190 FORWARD LENGTH=276 | 5.0e-24 | 63% |
RefSeq | Arabidopsis thaliana | NP_181539.1 | chlorophyll a-b binding protein CP29.3 [Arabidopsis thaliana] | 6.0e-24 | 63% |
RefSeq | Populus trichocarpa | XP_002309134.1 | light-harvesting complex II protein Lhcb4 [Populus trichocarpa] | 3.0e-24 | 65% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PRU3
Fln msg: STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 72 - 249
Fln protein:
W
Protein Length:
73
Fln nts:
T
Fln Alignment:
GD4IA4404I843J___IEALLVGGAEVYRNGELDPEKRIYPGG-FFDPLALASDDSDRTAKLREAEIKHGRLAMIAFLGFSVQA
C0PRU3_______________IEVLLLGYIEFQRNAEVDPETRLYPGGKYFDPFGLAVDEIKKD-RLKLAEIKHARLAMVAFLIFAIQA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain