UniGene Name: sp_v3.0_unigene80098
Length: 104 nt
UniGene Fasta |
---|
>sp_v3.0_unigene80098
G |
Ace file of the UniGene sp_v3.0_unigene80098 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Non-discriminatory gln-glu-trna synthetase n=1 Tax=Chlamydomonas reinhardtii RepID=A8I629_CHLRE | - | - | 5.0e-09 | 87% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Glutamyl-tRNA synthetase | - | - | 9.93e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutamate--tRNA ligase. | EC:6.1.1.17 | - | 1.561e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Porphyrin and chlorophyll metabolism | 00860 | 1.561e-14 | % | |
Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 1.561e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 1.561e-14 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.561e-14 | % |
Source | Gene names |
---|---|
Sma3 | At5g64050; CHLREDRAFT_195574; GRS; GSVIVT00036298001; GTS2; GluRS_2; MHJ24.3; MICPUCDRAFT_21054; MICPUN_93354; OJ1020_C02.10; OSJNBb0088N06.19; OSTLU_49888; Os02g0121000; OsI_05632; OsJ_05163; Ot01g04070; PHATRDRAFT_52655; PHYPADRAFT_137714; POPTRDRAFT_80 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | glutamate-tRNA ligase activity | GO:0004818 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | glutamyl-tRNA aminoacylation | GO:0006424 | Biological Process | 0.0 | - |
Sma3 | mitochondrion organization | GO:0007005 | Biological Process | 0.0 | - |
Sma3 | chloroplast organization | GO:0009658 | Biological Process | 0.0 | - |
Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutamyl/glutaminyl-tRNA synthetase, class Ib | IPR000924 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Glutamyl-tRNA synthetase, class Ib, bacterial/mitochondrial | IPR004527 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, anticodon-binding | IPR008925 | - | 0.0 | - |
Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G64050.1 | ATERS, OVA3, ERS glutamate tRNA synthetase chr5:25630196-25633099 REVERSE LENGTH=570 | 3.0e-12 | 81% |
RefSeq | Arabidopsis thaliana | NP_201210.1 | glutamyl-tRNA synthetase [Arabidopsis thaliana] | 4.0e-12 | 81% |
RefSeq | Populus trichocarpa | XP_002313571.1 | predicted protein [Populus trichocarpa] | 4.0e-12 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPV9
Fln msg: Distance to subject end: 296 aas, your sequence is shorter than subject: 34 - 581
Fln protein:
V
Protein Length:
35
Fln nts:
G
Fln Alignment:
GD4IA4404JL820___VYNFCVAADDALMQITHVIRAEEHLPNTLRQVL
B8LPV9_______________VYNFCVAVDDASMGISHVIRAEEHLPNTLRQAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain