UniGene Name: sp_v3.0_unigene80079
Length: 161 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80079
C |
Ace file of the UniGene sp_v3.0_unigene80079 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glyceraldehyde-3-phosphate dehydrogenase n=1 Tax=Moniliophthora perniciosa FA553 RepID=E2LX05_MONPE | - | - | 6.0e-15 | 88% |
| FL-Next | sp=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic; Taxus baccata (English yew). | - | - | 0.0 | 69% |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase | - | - | 5.043e-31 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). | EC:1.2.1.12 | - | 5.67e-25 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 5.67e-25 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.67e-25 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 5.67e-25 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g79530; At1g79530/T8K14_5; CHLREDRAFT_140618; G3PDH; GAP1a|GAP1b; GAPC; GAPC1; GAPD1; GAPDH; GPC; GapC; GapC1; OsI_026680; PHATRDRAFT_22122; PHYPADRAFT_226280; POPTRDRAFT_575307; POPTRDRAFT_728998; RCOM_1507100; RCOM_2049270; T8K14.5; THAPSDRAFT_31383; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating) activity | GO:0043891 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity | GO:0047100 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR000173 | - | 0.0 | - | |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G79530.1 | GAPCP-1 glyceraldehyde-3-phosphate dehydrogenase of plastid 1 chr1:29916232-29919088 REVERSE LENGTH=422 | 5.0e-13 | 70% |
| RefSeq | Arabidopsis thaliana | NP_178071.1 | glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana] | 7.0e-13 | 70% |
| RefSeq | Populus trichocarpa | XP_002318114.1 | predicted protein [Populus trichocarpa] | 3.0e-13 | 70% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q41595
Fln msg: your sequence is shorter than subject: 44 - 340
Fln protein:
D
Protein Length:
45
Fln nts:
C
Fln Alignment:
GD4IA4404JOX5Q___DANAGIQLNKTFVKLIAWYDNEWGYSRRVCDLLVYV
Q41595_______________DAKAGIALNDNFVKLVSWYDNEWGYSSRVIDLIVHM

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)