UniGene Name: sp_v3.0_unigene80058
Length: 180 nt
UniGene Fasta |
---|
>sp_v3.0_unigene80058
T |
Ace file of the UniGene sp_v3.0_unigene80058 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative helicase [Oryza sativa Japonica Group] | - | - | 2.0e-24 | 89% |
FL-Next | sp=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 49% |
Sma3 | Putative RNA helicase A | - | - | 3.02e-11 | - |
Source | Gene names |
---|---|
Sma3 | At2g01130; At2g30800; At2g35920; B1143G03.7-1; F11I4_16; GSVIVT00003545001; GSVIVT00009138001; GSVIVT00017756001; GSVIVT00018850001; GSVIVT00030427001; LOC_Os03g53760; MICPUCDRAFT_197; MICPUCDRAFT_45131; MICPUCDRAFT_45812; MICPUN_77912; MICPUN_79480; MICP |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | chalcone isomerase activity | GO:0045430 | Molecular Function | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G48650.2 | DEA(D/H)-box RNA helicase family protein chr1:17989517-17995169 REVERSE LENGTH=1206 | 2.0e-29 | 86% |
RefSeq | Arabidopsis thaliana | NP_175298.2 | DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] | 3.0e-29 | 86% |
RefSeq | Populus trichocarpa | XP_002316463.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-30 | 89% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q38953
Fln msg: Distance to subject end: 331 aas, your sequence is shorter than subject: 59 - 1168
Fln protein:
P
Protein Length:
60
Fln nts:
T
Fln Alignment:
GD4IA4404I5Y5Z___PPPDVRKIVLATNMAETSITINDVVFVVDCGKAKETSYDALNNAPCLLPTWISKASARQ
Q38953_______________PPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain