|
||||||
|
UniGene Name: sp_v3.0_unigene80040
Length: 186 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80040
G |
|
Ace file of the UniGene sp_v3.0_unigene80040
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide, putative [Oryza sativa Japonica Group] gb|EAZ27214.1| hypothetical protein OsJ_11153 [Oryza sativa Japonica Group] | - | - | 7.0e-18 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.118e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g11290; At1g15510; At1g20230; At1g56690; At1g74600; At2g22070; At2g22410; At3g11460; At3g12770; At3g13770; At3g46790; At4g02750; At4g19191; At4g21300; At4g33990; At5g04780; At5g08510; At5g39350; At5g48910; At5g66520; B1032F05.19; B1080A02.28; B1358B12. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR000634 | - | 0.0 | - |
| Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
| Sma3 | Nuclear control of ATP synthase 2 | IPR013946 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 2.0e-21 | 63% |
| RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-21 | 63% |
| RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 167 aas, your sequence is shorter than subject: 61 - 312
Fln protein:
V
Protein Length:
62
Fln nts:
G
Fln Alignment:
GD4IA4404IU7IY___VDLLGRAGRLDEAEDFIKRMPLKPDTAVWGALLGACRIHCNVELGERAAEKIFALEPENAG
D5ADG9_______________VDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAELLLNLDPDNAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
