UniGene Name: sp_v3.0_unigene80035
Length: 236 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene80035
A |
Ace file of the UniGene sp_v3.0_unigene80035
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Laccase n=2 Tax=Pinus taeda RepID=Q9AUI3_PINTA | - | - | 3.0e-31 | 96% |
| FL-Next | sp=Laccase-3; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 74% |
| Sma3 | Laccase, putative | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
| Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g18140; At2g29130; At2g30210; At2g38080; At2g40370; At5g01190; At5g03260; At5g05390; At5g07130; At5g09360; At5g48100; At5g58910; B1026C12.14; B1045D11.30; B1088C09.5; F15A17_290; F16M14.1; F7J8.170; GLac90; GSVIVT00001780001; GSVIVT00005407001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
| Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G40370.1 | LAC5 laccase 5 chr2:16858192-16860593 REVERSE LENGTH=580 | 1.0e-29 | 76% |
| RefSeq | Arabidopsis thaliana | NP_181568.1 | laccase 5 [Arabidopsis thaliana] | 1.0e-29 | 76% |
| RefSeq | Populus trichocarpa | XP_002312186.1 | laccase 90a [Populus trichocarpa] | 4.0e-31 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q941X2
Fln msg: Distance to subject end: 463 aas, your sequence is shorter than subject: 78 - 567
Fln protein:
T
Protein Length:
79
Fln nts:
A
Fln Alignment:
GD4IA4404H5TB5___LCVPHNIITVNGQFPGPTLHVRNGDTLVVKVYNNAQYNATIHWHGVRQFRTGWSDGPEYITQC
Q941X2_______________LCKTHNVITVNGQLPGPTLEVREGDTVVINVVNHAQYNVTIHWHGIRQFRTGWADGPEFVTQC

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta