UniGene Name: sp_v3.0_unigene80019
Length: 237 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene80019
G |
Ace file of the UniGene sp_v3.0_unigene80019 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] gb|EAZ12522.1| hypothetical protein OsJ_02419 [Oryza sativa Japonica Group] | - | - | 2.0e-14 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Sma3 | Tetratricopeptide-like helical | - | - | 1.209e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g04840; At1g47580; At2g15690; At2g22070; At3g03580; At3g11460; At3g12770; At3g24000; At3g26782; At3g49170; At3g56550; At3g57430; At4g02750; At4g16835; At4g30700; At4g33990; At4g37380; At5g09950; At5g46460; At5g66520; B1032F05.19; DYW10; DYW9; EMB2261; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G22070.1 | pentatricopeptide (PPR) repeat-containing protein chr2:9383602-9385962 FORWARD LENGTH=786 | 1.0e-18 | 76% |
RefSeq | Arabidopsis thaliana | NP_179798.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-18 | 76% |
RefSeq | Populus trichocarpa | XP_002300144.1 | predicted protein [Populus trichocarpa] | 5.0e-19 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 43 - 246
Fln protein:
V
Protein Length:
44
Fln nts:
G
Fln Alignment:
GD4IA4404IX91O___VCGDCHTFTKSVSKIVGRQIILRDTTRFHHFKDGLCSCGDYW
D5AAE0_______________VCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain