UniGene Name: sp_v3.0_unigene79962
Length: 189 nt
![]() |
---|
>sp_v3.0_unigene79962
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | serine/threonine-protein kinase SRK2A [Arabidopsis thaliana] sp|P43291.1|SRK2A_ARATH RecName: Full=Serine/threonine-protein kinase SRK2A; AltName: Full=Arabidopsis protein SK1; AltName: Full=OST1-kinase-like 7; AltName: Full=SNF1-related kinase 2.4; Short | - | - | 3.0e-13 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
Sma3 | Serine/threonine-protein kinase SAPK7 | - | - | 3.696e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 1.04901e-41 | - |
Source | Gene names |
---|---|
Sma3 | 41K; AAPK; ASK1; ASK2; AT5G63650; At1g10940; At1g60940; At1g78290; At2g23030; At3g50500; At4g33950; At4g40010; At5g08590; At5g63650; At5g66880; B0308C03.1; B0518A01.2; BSK1; BSK2; CHLREDRAFT_113331; F17I5.140; F21P24.9; F3F9.17; GDBrPK; GSVIVT00009710001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
Sma3 | regulation of seed germination | GO:0010029 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR015740 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G10940.2 | - | 3.0e-18 | 77% |
RefSeq | Arabidopsis thaliana | NP_172563.1 | serine/threonine-protein kinase SRK2A [Arabidopsis thaliana] | 3.0e-18 | 77% |
RefSeq | Populus trichocarpa | XP_002330438.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 77% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWJ2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 193 aas, your sequence is shorter than subject: 47 - 427
Fln protein:
S
Protein Length:
48
Fln nts:
G
Fln Alignment:
GD4IA4404IRQ1J___SCKEYDGKVADVWACGATLYAMLVGAYPFEDQGDRKNFRKAIQ
A9NWJ2_______________SRKEYDGKLADVWSCGVTLYVMLVGAYPFEDQDDPKNFRKTIQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain