UniGene Name: sp_v3.0_unigene79933
Length: 193 nt
UniGene Fasta |
---|
>sp_v3.0_unigene79933
G |
Ace file of the UniGene sp_v3.0_unigene79933 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase-like protein (Fragment) n=1 Tax=Prunus cerasus var. caproniana RepID=A8BN32_9ROSA | - | - | 3.0e-15 | 60% |
FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 50% |
Sma3 | Kinase-like protein | - | - | 1.083e-08 | - |
Source | Gene names |
---|---|
Sma3 | GSVIVT00002249001; GSVIVT00004217001; GSVIVT00005204001; GSVIVT00012634001; GSVIVT00014285001; GSVIVT00017170001; GSVIVT00018756001; GSVIVT00018759001; GSVIVT00018766001; GSVIVT00018767001; GSVIVT00018948001; GSVIVT00025191001; GSVIVT00028428001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | proton-transporting V-type ATPase, V0 domain | GO:0033179 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | hydrogen ion transmembrane transporter activity | GO:0015078 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
Sma3 | ATPase, V0 complex, proteolipid subunit C | IPR000245 | - | 0.0 | - |
Sma3 | ATPase, F0 complex, subunit A | IPR000568 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Copine | IPR010734 | - | 0.0 | - |
Sma3 | ATPase, V0 complex, proteolipid subunit C, eukaryotic | IPR011555 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G24130.1 | Leucine-rich receptor-like protein kinase family protein chr2:10258148-10261220 FORWARD LENGTH=980 | 1.0e-18 | 55% |
RefSeq | Arabidopsis thaliana | NP_179990.1 | putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 2.0e-18 | 55% |
RefSeq | Populus trichocarpa | XP_002337529.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-20 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 140 aas, your sequence is shorter than subject: 63 - 998
Fln protein:
L
Protein Length:
64
Fln nts:
G
Fln Alignment:
GD4IA4404JIQHL___IAIDIAEGMAYLHHYCVMRVIHCDLKPNNVLLDEDMTAHLIDFGIATI---CSANSEDSS
Q19AV8_______________IALGAAQGLAYLHHGCVPAIVHRDVKSNNILLDEDYVAHVADFGVAKILQSCARGADSMS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain