SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene79867

Length: 142 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene79867
CAGGGTCACATCCCGTTTGGGTATGCAACTGATGAGGACCCCTCGAGTTGATGCCTCTCACTCATGTGCTGGCTACCAAGCTGGGAGCAAAGCTCACAGAGGTCAGAAAGAATGGAACCTGCTCCTGGTTGAGGCCTGATGG

Ace file of the UniGene sp_v3.0_unigene79867 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	S-adenosylmethionine synthase 1 n=24 Tax=Tracheophyta RepID=METK1_VITVI	-	-	8.0e-12	96%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	100%
Sma3	S-adenosylmethionine synthetase	-	-	4.933e-24	-

Source	ECs	Term	Type	e value	Identity
Sma3	Methionine adenosyltransferase.	EC:2.5.1.6	-	1.769e-37	-

Source	KEGGs	Term	e value	Identity
Sma3	Cysteine and methionine metabolism	00270	1.769e-37	%
Sma3	Biosynthesis of plant hormones	01070	1.769e-37	%
Sma3	Metabolic pathways	01100	1.769e-37	%
Sma3	Biosynthesis of secondary metabolites	01110	1.769e-37	%

Source	Gene names
Sma3	AT4G01850; AdoMet1; AdoMet3; AdoMet4; AdoMet5; AdoMet6; AdoMet_e2; At2g36880; CC2188; CHLRE_182408; GSVIVT00000624001; GSVIVT00014324001; GSVIVT00022173001; GSVIVT00022531001; GSVIVT00029885001; LOC_Os01g18860; MAT; METK; METK-1; METK-2; METK1; METK2; MET

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	methionine adenosyltransferase activity	GO:0004478	Molecular Function	-
Sma3	enzyme inhibitor activity	GO:0004857	Molecular Function	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	pectinesterase activity	GO:0030599	Molecular Function	-
Sma3	potassium ion binding	GO:0030955	Molecular Function	-
Sma3	cobalt ion binding	GO:0050897	Molecular Function	-
Sma3	one-carbon metabolic process	GO:0006730	Biological Process	-
Sma3	lignin biosynthetic process	GO:0009809	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	S-adenosylmethionine synthetase	IPR002133	-	-
Sma3	Pectinesterase inhibitor	IPR006501	-	-
Sma3	Heavy-metal-associated, conserved site	IPR017969	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G17390.1	MTO3, SAMS3, MAT4 S-adenosylmethionine synthetase family protein chr3:5952484-5953665 REVERSE LENGTH=393	3.0e-15	96%
RefSeq	Arabidopsis thaliana	NP_188365.1	S-adenosylmethionine synthase 4 [Arabidopsis thaliana]	4.0e-15	96%
RefSeq	Populus trichocarpa	XP_002314993.1	s-adenosylmethionine synthetase 3 [Populus trichocarpa]	2.0e-14	90%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PSM3

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 116 aas, your sequence is shorter than subject: 46 - 284

Fln protein: GSHPVWVCN**GPLELMPLTHVLATKLGAKLTEVRKNGTCSWLRPD

Protein Length: 47

Fln nts: CAGGGTCACATCCCGTTTGGGTATGCAACTGATGAGGACCCCTCGAGTTGATGCCTCTCACTCATGTGCTGGCTACCAAGCTGGGAGCAAAGCTCACAGAGGTCAGAAAGAATGGAACCTGCTCCTGGTTGAGGCCTGATGG

Fln Alignment:

GD4IA4404IVVD0___ELMPLTHVLATKLGAKLTEVRKNGTCSWLRPD
C0PSM3_______________ELMPLTHVLATKLGAKLTEVRKNGTCSWLRPD

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain