UniGene Name: sp_v3.0_unigene79841
Length: 223 nt
![]() |
---|
>sp_v3.0_unigene79841
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | R2R3 type Myb1 transcription factor n=1 Tax=Leucaena leucocephala RepID=F4YCA2_LEUGL | - | - | 3.0e-17 | 79% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | R2R3-Myb1 transcription factor | - | - | 1.858e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT4g37780; At2g36890; At3g49690; At4g37780; At5g23000; At5g56110; At5g57620; At5g65790; AtMYB84; DcMYB4; F6H11.100; GSVIVT00000055001; GSVIVT00000629001; GSVIVT00010034001; GSVIVT00015010001; GSVIVT00020833001; GSVIVT00022176001; GSVIVT00029221001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | - |
Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | tapetal layer development | GO:0048658 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | Protein of unknown function DUF1677, Oryza sativa | IPR012871 | - | 0.0 | - |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G65790.1 | ATMYB68, MYB68 myb domain protein 68 chr5:26323035-26324385 FORWARD LENGTH=374 | 2.0e-22 | 60% |
RefSeq | Arabidopsis thaliana | NP_201380.1 | myb domain protein 68 [Arabidopsis thaliana] | 2.0e-22 | 60% |
RefSeq | Populus trichocarpa | XP_002301137.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-24 | 81% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKH9
Fln msg: Distance to subject end: 264 aas, your sequence is shorter than subject: 74 - 415
Fln protein:
I
Protein Length:
75
Fln nts:
A
Fln Alignment:
GD4IA4404IU2XP___IICTMYTSIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGKCSKDNDNQQIRRLLAKEAAKGAGIRGLYNGD
B8LKH9_______________IICSLYTSIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGKCTKDNDNQQIRRLLAKEAAKGAGIRRPYNGD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain