|
||||||
|
UniGene Name: sp_v3.0_unigene79832
Length: 185 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene79832
G |
|
Ace file of the UniGene sp_v3.0_unigene79832
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pleiotropic drug resistance protein 3 n=4 Tax=Oryza sativa RepID=PDR3_ORYSJ | - | - | 5.0e-19 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 9.921e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 9.932e-16 | - |
| Sma3 | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 1.403e-06 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 9.393e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | B1090H08.39; GSVIVT00012684001; GSVIVT00032575001; GSVIVT00034493001; GSVIVT00034498001; GSVIVT00034501001; GSVIVT00034508001; GSVIVT00034512001; GSVIVT00034517001; GSVIVT00034519001; GSVIVT00034523001; LOC_Os01g42350; LOC_Os01g42370; LOC_Os01g42410; NtPD |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G15520.1 | PDR12, ATPDR12, ABCG40, ATABCG40 pleiotropic drug resistance 12 chr1:5331993-5338175 REVERSE LENGTH=1423 | 4.0e-19 | 54% |
| RefSeq | Arabidopsis thaliana | NP_173005.1 | ABC transporter G family member 40 [Arabidopsis thaliana] | 5.0e-19 | 54% |
| RefSeq | Populus trichocarpa | XP_002303856.1 | predicted protein [Populus trichocarpa] | 6.0e-24 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW55
Fln msg: Distance to subject end: 83 aas, your sequence is shorter than subject: 61 - 471
Fln protein:
K
Protein Length:
62
Fln nts:
G
Fln Alignment:
GD4IA4404H57VJ___KFFWYSFMMFFTLLYTTYYGMLMVGLSPNAAIASVLSSACIAMWMVFCGFIVPRPRIPVWW
A9NW55_______________KFFWYLFVTLCHFLYFTYYGMLTVAISPNAQVAAVISSAFYSIFNLFSGFLITRPQLPRWW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
